Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	389856
Gene name Gene Name - the full gene name approved by the HGNC.	Ubiquitin specific peptidase 27 X-linked
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	USP27X
Synonyms (NCBI Gene) Gene synonyms aliases	MRX105, USP22L, USP27, XLID105
Chromosome Chromosome number	X
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	Xp11.23
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the peptidase protein family. The encoded protein functions as a deubiquitinase that is involved in upregulation of the pro-apoptotic Bim protein. This protein may act as a tumor suppressor by increasing levels of Bim to coun

Show/Hide all(1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs886038211	T>C	Pathogenic	Missense variant, coding sequence variant

Show/Hide all(37)

miRTarBase ID	miRNA	Experiments	Reference
MIRT609441	hsa-miR-8485	HITS-CLIP	23824327
MIRT609440	hsa-miR-603	HITS-CLIP	23824327
MIRT609439	hsa-miR-302c-5p	HITS-CLIP	23824327
MIRT609438	hsa-miR-552-5p	HITS-CLIP	23824327
MIRT609441	hsa-miR-8485	HITS-CLIP	23824327
MIRT609440	hsa-miR-603	HITS-CLIP	23824327
MIRT609439	hsa-miR-302c-5p	HITS-CLIP	23824327
MIRT609438	hsa-miR-552-5p	HITS-CLIP	23824327
MIRT609439	hsa-miR-302c-5p	HITS-CLIP	27418678
MIRT609439	hsa-miR-302c-5p	HITS-CLIP	27418678
MIRT609438	hsa-miR-552-5p	HITS-CLIP	27418678
MIRT609438	hsa-miR-552-5p	HITS-CLIP	27418678
MIRT609441	hsa-miR-8485	HITS-CLIP	27418678
MIRT609441	hsa-miR-8485	HITS-CLIP	27418678
MIRT609441	hsa-miR-8485	HITS-CLIP	23824327
MIRT609440	hsa-miR-603	HITS-CLIP	23824327
MIRT609439	hsa-miR-302c-5p	HITS-CLIP	23824327
MIRT609438	hsa-miR-552-5p	HITS-CLIP	23824327
MIRT609441	hsa-miR-8485	HITS-CLIP	23824327
MIRT609440	hsa-miR-603	HITS-CLIP	23824327
MIRT609439	hsa-miR-302c-5p	HITS-CLIP	23824327
MIRT609438	hsa-miR-552-5p	HITS-CLIP	23824327
MIRT1478457	hsa-miR-4446-5p	CLIP-seq
MIRT1922469	hsa-miR-1260	CLIP-seq
MIRT1922470	hsa-miR-1260b	CLIP-seq
MIRT1922471	hsa-miR-188-3p	CLIP-seq
MIRT1922472	hsa-miR-3156-3p	CLIP-seq
MIRT1922473	hsa-miR-4443	CLIP-seq
MIRT1922474	hsa-miR-765	CLIP-seq
MIRT2144113	hsa-miR-3160-5p	CLIP-seq
MIRT2144114	hsa-miR-4436b-5p	CLIP-seq
MIRT2144115	hsa-miR-485-3p	CLIP-seq
MIRT2144116	hsa-miR-544	CLIP-seq
MIRT2144117	hsa-miR-578	CLIP-seq
MIRT2144118	hsa-miR-660	CLIP-seq
MIRT2144115	hsa-miR-485-3p	CLIP-seq
MIRT2144118	hsa-miR-660	CLIP-seq

Show/Hide all(30)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002376	Process	Immune system process	IEA
GO:0004197	Function	Cysteine-type endopeptidase activity	IDA	31534008, 32027733
GO:0004843	Function	Cysteine-type deubiquitinase activity	IEA
GO:0004843	Function	Cysteine-type deubiquitinase activity	ISS
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IEA
GO:0006508	Process	Proteolysis	IEA
GO:0008233	Function	Peptidase activity	IEA
GO:0008234	Function	Cysteine-type peptidase activity	IEA
GO:0016579	Process	Protein deubiquitination	IEA
GO:0016579	Process	Protein deubiquitination	ISS
GO:0016787	Function	Hydrolase activity	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IEA
GO:0043065	Process	Positive regulation of apoptotic process	ISS
GO:0045087	Process	Innate immune response	IEA
GO:0050821	Process	Protein stabilization	IDA	31534008
GO:0050821	Process	Protein stabilization	IEA
GO:0050821	Process	Protein stabilization	ISS
GO:0051607	Process	Defense response to virus	IMP	31534008
GO:0060340	Process	Positive regulation of type I interferon-mediated signaling pathway	IDA	31534008
GO:0061578	Function	K63-linked deubiquitinase activity	IEA
GO:0061578	Function	K63-linked deubiquitinase activity	ISS
GO:0070536	Process	Protein K63-linked deubiquitination	IEA
GO:0070536	Process	Protein K63-linked deubiquitination	ISS
GO:0071108	Process	Protein K48-linked deubiquitination	IDA	31534008
GO:0071108	Process	Protein K48-linked deubiquitination	IEA
GO:0071108	Process	Protein K48-linked deubiquitination	ISS
GO:1990380	Function	K48-linked deubiquitinase activity	IEA
GO:1990380	Function	K48-linked deubiquitinase activity	ISS

MIM	HGNC	e!Ensembl
300975	13486	ENSG00000273820

Protein

UniProt ID

A6NNY8

Protein name

Ubiquitin carboxyl-terminal hydrolase 27 (EC 3.4.19.12) (Deubiquitinating enzyme 27) (Ubiquitin carboxyl-terminal hydrolase 22-like) (Ubiquitin thioesterase 27) (Ubiquitin-specific-processing protease 27) (X-linked ubiquitin carboxyl-terminal hydrolase 27

Protein function

Deubiquitinase involved in innate antiviral immunity by mediating deubiquitination of CGAS and RIGI (PubMed:31534008, PubMed:32027733). Negatively regulates RIGI by mediating 'Lys-63'-linked deubiquitination of RIGI, inhibiting type I interferon

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00443	UCH	78 → 418	Ubiquitin carboxyl-terminal hydrolase	Family

Sequence

MCKDYVYDKDIEQIAKEEQGEALKLQASTSTEVSHQQCSVPGLGEKFPTWETTKPELELL
GHNPRRRRITSSFTIGLRGLINLGNTCFMNCIVQALTHTPILRDFFLSDRHRCEMPSPEL
CLVCEMSSLFRELYSGNPSPHVPYKLLHLVWIHARHLAGYRQQDAHEFLIAALDVLHRHC
KGDDVGKAANNPNHCNCIIDQIFTGGLQSDVTCQACHGVSTTIDPCWDISLDLPGSCTSF
WPMSPGRESSVNGESHIPGITTLTDCLRRFTRPEHLGSSAKIKCGSCQSYQESTKQLTMN
KLPVVACFHFKRFEHSAKQRRKITTYISFPLELDMTPFMASSKESRMNGQLQLPTNSGNN
ENKYSLFAVVNHQGTLESGHYTSFIRHHKDQWFKCDDAVITKASIKDVLDSEGYLLFYHK
QVLEHESEKVKEMNTQAY

Sequence length

438

Interactions

View interactions

Show/Hide Causal Diseases (2)

Disease merge term	Disease name	dbSNP ID	References
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Mental retardation	intellectual disability	rs1601932069	N/A
Mental Retardation, X-Linked	Intellectual disability, X-linked 105	rs886038210, rs886038211	N/A

Show/Hide Text Mining Associations (9)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Breast Neoplasms	Associate	36001804, 38030604
Carcinogenesis	Associate	35018513
Carcinogenesis	Inhibit	38030604
Carcinoma Hepatocellular	Associate	35018513
Intellectual Disability	Associate	38182161, 38273165
Melanoma	Associate	35044632
Neoplasms	Associate	35018513, 36001804
Neurologic Manifestations	Associate	38273165
Pathological Conditions Signs and Symptoms	Associate	38273165

USP27X (ubiquitin specific peptidase 27 X-linked)