CFAP77 (cilia and flagella associated protein 77)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein
Entrez ID 389799
Gene name Cilia and flagella associated protein 77
Gene symbol CFAP77
Synonyms (NCBI Gene)
C9orf171
Chromosome 9
Chromosome location 9q34.13
miRNA miRNA information provided by mirtarbase database.
14
Gene miRNA Gene ontology Other IDs Protein
Show/Hide all (14)
miRTarBase ID miRNA Experiments Reference
MIRT717996 hsa-miR-596 HITS-CLIP 19536157
MIRT717995 hsa-miR-6808-5p HITS-CLIP 19536157
MIRT717994 hsa-miR-6893-5p HITS-CLIP 19536157
MIRT717993 hsa-miR-940 HITS-CLIP 19536157
MIRT717992 hsa-miR-18a-3p HITS-CLIP 19536157
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
15
Gene miRNA Gene ontology Other IDs Protein
Show/Hide all (15)
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 25416956
GO:0005737 Component Cytoplasm IEA
GO:0005856 Component Cytoskeleton IEA
GO:0005879 Component Axonemal microtubule IDA 36191189
GO:0005929 Component Cilium IDA 28282151
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein
MIM HGNC e!Ensembl
621136 33776 ENSG00000188523
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q6ZQR2
Protein name Cilia- and flagella-associated protein 77
Protein function Microtubule inner protein (MIP) part of the dynein-decorated doublet microtubules (DMTs) in cilia axoneme, which is required for motile cilia beating.
PDB 7UNG , 8J07
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF14825 DUF4483 100 → 240 Domain of unknown function (DUF4483) Family
Tissue specificity TISSUE SPECIFICITY: Expressed in airway epithelial cells. {ECO:0000269|PubMed:36191189}.
Sequence 
MPEARSSGPDLTRWRKQQQPVRRTVSQVCPPPRRPLTVADIRSGMENERLGVVRDSMFQN
PLIVKAAGPASVGTSYSVYDSSAVQKVIPSLAGHHIKGGPQAELGKPRERSYSLPGINFN
YGLYIRGLDGGVPEAIGRWNVFKQQPTCPHELTRNYIAMNRGAVKAGLVTARENLLYRQL
NDIRISDQDDRRMKKEPPPLPPNMTFGIRARPSTPFFDLLQHRYLQLWVQEQKATQKAIK
LEKKQKVVLGKLYETRSSQLRKYKPPVKLDTLWHMPHFQKVGRHLDTFPTEADRQRALKA
HREECAVRQGTLRMGNYTHP
Sequence length 320
Interactions View interactions