Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
389692
Gene name Gene Name - the full gene name approved by the HGNC.
MAF bZIP transcription factor A
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
MAFA
Synonyms (NCBI Gene) Gene synonyms aliases
INSDM, RIPE3b1, hMafA
Chromosome Chromosome number
8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
8q24.3
Summary Summary of gene provided in NCBI Entrez Gene.
MAFA is a transcription factor that binds RIPE3b, a conserved enhancer element that regulates pancreatic beta cell-specific expression of the insulin gene (INS; MIM 176730) (Olbrot et al., 2002 [PubMed 12011435]).[supplied by OMIM, Mar 2008]
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs1554635488 G>A Likely-pathogenic Coding sequence variant, missense variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT1125272 hsa-miR-1197 CLIP-seq
MIRT1125273 hsa-miR-214 CLIP-seq
MIRT1125274 hsa-miR-3144-5p CLIP-seq
MIRT1125275 hsa-miR-3179 CLIP-seq
MIRT1125276 hsa-miR-34b CLIP-seq
Transcription factors
Transcription factor Regulation Reference
ATF6 Repression 18450959
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IEA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
610303 23145 ENSG00000182759
Protein
UniProt ID Q8NHW3
Protein name Transcription factor MafA (Pancreatic beta-cell-specific transcriptional activator) (RIPE3b1 factor) (V-maf musculoaponeurotic fibrosarcoma oncogene homolog A)
Protein function Transcription factor that activates insulin gene expression (PubMed:12011435, PubMed:15993959). Acts synergistically with NEUROD1/BETA2 and PDX1 (PubMed:15993959). Binds the insulin enhancer C1/RIPE3b element (PubMed:12011435). Binds to consensu
PDB 4EOT
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF08383 Maf_N 111 144 Maf N-terminal region Family
PF03131 bZIP_Maf 227 318 bZIP Maf transcription factor Coiled-coil
Tissue specificity TISSUE SPECIFICITY: Expressed in the islets of Langerhans (at protein level). {ECO:0000269|PubMed:12917329}.
Sequence
MAAELAMGAELPSSPLAIEYVNDFDLMKFEVKKEPPEAERFCHRLPPGSLSSTPLSTPCS
SVPSSPSFCAPSPGTGGGGGAGGGGGSSQAGGAPGPPSGGPGAVGGTSGKPALEDLYWMS
GYQHHLNPEALNLTPEDAVEALIG
SGHHGAHHGAHHPAAAAAYEAFRGPGFAGGGGADDM
GAGHHHGAHHAAHHHHAAHHHHHHHHHHGGAGHGGGAGHHVRLEERFSDDQLVSMSVREL
NRQLRGFSKEEVIRLKQKRRTLKNRGYAQSCRFKRVQQRHILESEKCQLQSQVEQLKLEV
GRLAKERDLYKEKYEKLA
GRGGPGSAGGAGFPREPSPPQAGPGGAKGTADFFL
Sequence length 353
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  
  Type II diabetes mellitus
Maturity onset diabetes of the young
 
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Islet Cell Adenomatosis islet cell adenomatosis rs1554635488 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Dementia Dementia N/A N/A GWAS
Diabetes Type 2 diabetes N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 34550610
Carcinoma Mucoepidermoid Associate 23018873
Cataract Associate 29339498
Colorectal Neoplasms Inhibit 32869528
Diabetes Mellitus Associate 29339498
Diabetes Mellitus Type 2 Associate 30372580
Epileptic Syndromes Associate 29339498
Glaucoma Associate 29339498
Insulin Resistance Associate 35872977
Lymphoma Large B Cell Diffuse Associate 32596373