Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene Gene ontology Other IDs Protein Associated diseases
Entrez ID	389658
Gene name	ALK and LTK ligand 1
Gene symbol	ALKAL1
Synonyms (NCBI Gene)	AUGAAUGBFAM150AUNQ9433
Chromosome	8
Chromosome location	8q11.23

Show/Hide all (23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005125	Function	Cytokine activity	IDA	34646012, 34819673
GO:0005125	Function	Cytokine activity	IEA
GO:0005515	Function	Protein binding	IPI	26418745
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IDA	34646012
GO:0005615	Component	Extracellular space	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0007169	Process	Cell surface receptor protein tyrosine kinase signaling pathway	IDA	30061385
GO:0007169	Process	Cell surface receptor protein tyrosine kinase signaling pathway	IDA	34646012, 34819673
GO:0010976	Process	Positive regulation of neuron projection development	IDA	26418745
GO:0016020	Component	Membrane	IEA
GO:0030297	Function	Transmembrane receptor protein tyrosine kinase activator activity	IDA	34646012, 34819673
GO:0030298	Function	Receptor signaling protein tyrosine kinase activator activity	IBA
GO:0030298	Function	Receptor signaling protein tyrosine kinase activator activity	IDA	26418745, 34646012, 34819673
GO:0030298	Function	Receptor signaling protein tyrosine kinase activator activity	IEA
GO:0030971	Function	Receptor tyrosine kinase binding	IBA
GO:0030971	Function	Receptor tyrosine kinase binding	IDA	26418745
GO:0030971	Function	Receptor tyrosine kinase binding	IEA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IBA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IDA	26418745
GO:0070378	Process	Positive regulation of ERK5 cascade	IBA
GO:0070378	Process	Positive regulation of ERK5 cascade	IDA	26418745

MIM	HGNC	e!Ensembl
619670	33775	ENSG00000196711

Q6UXT8

Protein name

ALK and LTK ligand 1 (Augmentor beta) (AUG-beta)

Protein function

Cytokine that acts as a physiological ligand for receptor tyrosine kinase LTK, leading to its activation (PubMed:25331893, PubMed:26418745, PubMed:26630010, PubMed:34646012, PubMed:34819673). Monomeric ALKAL1 binds to LTK, leading to LTK homodim

PDB

7MK7 , 7MZZ , 7NX0

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF15129	FAM150	51 → 129	FAM150 family	Family

Tissue specificity

TISSUE SPECIFICITY: Widely expressed with highest levels in thyroid and moderate levels in stomach, trachea, small intestine, prostate and brain. {ECO:0000269|PubMed:25331893}.

Sequence

MRPLKPGAPLPALFLLALALSPHGAHGRPRGRRGARVTDKEPKPLLFLPAAGAGRTPSGS
RSAEIFPRDSNLKDKFIKHFTGPVTFSPECSKHFHRLYYNTRECSTPAYYKRCARLLTRL
AVSPLCSQT

Sequence length

129

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (3)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Autoimmune Diseases	Associate	34646012	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Associate	22610075, 25332168, 29520901	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	29520901	★★★★★ ★☆☆☆☆ Found in Text Mining only

ALKAL1 (ALK and LTK ligand 1)