Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
389549
Gene name Gene Name - the full gene name approved by the HGNC.
FEZ family zinc finger 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
FEZF1
Synonyms (NCBI Gene) Gene synonyms aliases
FEZ, HH22, ZNF312B
Chromosome Chromosome number
7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
7q31.32
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a transcriptional repressor that belongs to the zinc finger double domain protein family. The encoded protein is thought to play a role in the embryonic migration of gonadotropin-releasing hormone neurons into the brain. Mutations in thi
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT995046 hsa-miR-3591-3p CLIP-seq
MIRT995047 hsa-miR-300 CLIP-seq
MIRT995048 hsa-miR-3163 CLIP-seq
MIRT995049 hsa-miR-338-5p CLIP-seq
MIRT995050 hsa-miR-381 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0000976 Function Transcription cis-regulatory region binding IEA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IEA
GO:0001227 Function DNA-binding transcription repressor activity, RNA polymerase II-specific IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
613301 22788 ENSG00000128610
Protein
UniProt ID A0PJY2
Protein name Fez family zinc finger protein 1 (Zinc finger protein 312B)
Protein function Transcription repressor. Involved in the axonal projection and proper termination of olfactory sensory neurons (OSN). Plays a role in rostro-caudal patterning of the diencephalon and in prethalamic formation. Expression is required in OSN to cel
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00096 zf-C2H2 260 282 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 288 310 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 316 338 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 344 366 Zinc finger, C2H2 type Domain
PF13912 zf-C2H2_6 371 397 Domain
PF00096 zf-C2H2 400 423 Zinc finger, C2H2 type Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in brain. Little or no expression in other tissues. Overexpressed specifically in gastric cancers. A 2- to 20-fold increase is found in over 50% of gastric cancer tissues. {ECO:0000269|PubMed:19318583}.
Sequence
MDSSCHNATTKMLATAPARGNMMSTSKPLAFSIERIMARTPEPKALPVPHFLQGALPKGE
PKHSLHLNSSIPCMIPFVPVAYDTSPKAGVTGSEPRKASLEAPAAPAAVPSAPAFSCSDL
LNCALSLKGDLARDALPLQQYKLVRPRVVNHSSFHAMGALCYLNRGDGPCHPAAGVNIHP
VASYFLSSPLHPQPKTYLAERNKLVVPAVEKYPSGVAFKDLSQAQLQHYMKESAQLLSEK
IAFKTSDFSRGSPNAKPKVFTCEVCGKVFNAHYNLTRHMPVHTGARPFVCKVCGKGFRQA
STLCRHKIIH
TQEKPHKCNQCGKAFNRSSTLNTHTRIHAGYKPFVCEFCGKGFHQKGNYK
NHKLTH
SGEKQFKCNICNKAFHQVYNLTFHMHTHNDKKPFTCPTCGKGFCRNFDLKKHVR
KLH
DSSLGLARTPAGEPGTEPPPPLPQQPPMTLPPLQPPLPTPGPLQPGLHQGHQ
Sequence length 475
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Hypogonadotropic Hypogonadism With Or Without Anosmia Hypogonadotropic hypogonadism 22 with anosmia rs587777739, rs587777740 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Attention Deficit Hyperactivity Disorder Attention deficit hyperactivity disorder N/A N/A GWAS
Kallmann Syndrome Kallmann syndrome N/A N/A GenCC
Oligodendroglioma Oligodendroglioma N/A N/A GWAS
Schizophrenia Schizophrenia N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 29510777
Attention Deficit Disorder with Hyperactivity Associate 31651322
Autistic Disorder Associate 26204995
Carcinogenesis Inhibit 35607960
Carcinoma Hepatocellular Stimulate 30365146
Carcinoma Non Small Cell Lung Associate 30416194, 32349744, 33174014
Carcinoma Non Small Cell Lung Stimulate 32590821
Carcinoma Ovarian Epithelial Associate 32135030
Carcinoma Pancreatic Ductal Associate 29348628
Choroiditis Stimulate 31076545