Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
389421
Gene name Gene Name - the full gene name approved by the HGNC.
Lin-28 RNA binding posttranscriptional regulator B
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
LIN28B
Synonyms (NCBI Gene) Gene synonyms aliases
CSDD2
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6q16.3-q21
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene belongs to the lin-28 family, which is characterized by the presence of a cold-shock domain and a pair of CCHC zinc finger domains. This gene is highly expressed in testis, fetal liver, placenta, and in primary human tumor
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT003834 hsa-let-7b-5p Luciferase reporter assay 16971064
MIRT003834 hsa-let-7b-5p Luciferase reporter assay 16971064
MIRT003834 hsa-let-7b-5p Luciferase reporter assay 16971064
MIRT003834 hsa-let-7b-5p Luciferase reporter assay 16971064
MIRT003834 hsa-let-7b-5p Luciferase reporter assay 16971064
Transcription factors
Transcription factor Regulation Reference
TBP Activation 23494474
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0003723 Function RNA binding HDA 22681889
GO:0003723 Function RNA binding IDA 19703396
GO:0005515 Function Protein binding IPI 19703396
GO:0005654 Component Nucleoplasm IDA
GO:0005730 Component Nucleolus IDA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
611044 32207 ENSG00000187772
Protein
UniProt ID Q6ZN17
Protein name Protein lin-28 homolog B (Lin-28B)
Protein function Suppressor of microRNA (miRNA) biogenesis, including that of let-7 and possibly of miR107, miR-143 and miR-200c. Binds primary let-7 transcripts (pri-let-7), including pri-let-7g and pri-let-7a-1, and sequester them in the nucleolus, away from t
PDB 4A4I
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00313 CSD 30 102 Domain
PF00098 zf-CCHC 127 144 Zinc knuckle Domain
PF00098 zf-CCHC 149 166 Zinc knuckle Domain
Tissue specificity TISSUE SPECIFICITY: Expressed at high levels in the placenta and, at mucher lower, in testis and fetal liver (PubMed:16971064). Isoform 1 is only detected in placenta and in moderately and poorly differentiated hepatocellular carcinoma cells (at protein l
Sequence
MAEGGASKGGGEEPGKLPEPAEEESQVLRGTGHCKWFNVRMGFGFISMINREGSPLDIPV
DVFVHQSKLFMEGFRSLKEGEPVEFTFKKSSKGLESIRVTGP
GGSPCLGSERRPKGKTLQ
KRKPKGDRCYNCGGLDHHAKECSLPPQPKKCHYCQSIMHMVANCPHKNVAQPPASSQGRQ
EAESQPCTSTLPREVGGGHGCTSPPFPQEARAEISERSGRSPQEASSTKSSIAPEEQSKK
GPSVQKRKKT
Sequence length 250
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Neuroblastoma Neuroblastoma rs113994087, rs113994089, rs281864719, rs863225285, rs863225284, rs863225283, rs281864720, rs863225282, rs863225281, rs1057519698, rs915983602, rs1469271544 22941191, 22911191, 28545128, 23042116
Schizophrenia Schizophrenia rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346
View all (12 more)
28991256, 26198764, 30285260
Unknown
Disease term Disease name Evidence References Source
Mental depression Major Depressive Disorder 27479909 ClinVar
Insomnia Insomnia GWAS
Mental Depression Mental Depression GWAS
Neuroticism Neuroticism GWAS
Associations from Text Mining
Disease Name Relationship Type References
Abortion Habitual Associate 35118391
Adenocarcinoma of Lung Associate 29301498
Aortic Aneurysm Abdominal Associate 37822152
Breast Neoplasms Associate 24885919, 31907362
Burkitt Lymphoma Associate 26325594
Calcinosis Cutis Associate 34779407
Carcinogenesis Associate 22225612, 24885919, 26080928, 26123663, 26481147, 29330293
Carcinoma Ductal Breast Associate 24885919
Carcinoma Hepatocellular Associate 24244607, 26080928, 29466730, 32571380, 33228611, 37269361
Carcinoma Non Small Cell Lung Associate 22225612, 24780874, 25277326, 25368430