Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	389421
Gene name Gene Name - the full gene name approved by the HGNC.	Lin-28 RNA binding posttranscriptional regulator B
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	LIN28B
Synonyms (NCBI Gene) Gene synonyms aliases	CSDD2
Chromosome Chromosome number	6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	6q16.3-q21
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene belongs to the lin-28 family, which is characterized by the presence of a cold-shock domain and a pair of CCHC zinc finger domains. This gene is highly expressed in testis, fetal liver, placenta, and in primary human tumor

Show/Hide all(328)

miRTarBase ID	miRNA	Experiments	Reference
MIRT003834	hsa-let-7b-5p	Luciferase reporter assay	16971064
MIRT003834	hsa-let-7b-5p	Luciferase reporter assay	16971064
MIRT003834	hsa-let-7b-5p	Luciferase reporter assay	16971064
MIRT003834	hsa-let-7b-5p	Luciferase reporter assay	16971064
MIRT003834	hsa-let-7b-5p	Luciferase reporter assay	16971064
MIRT003834	hsa-let-7b-5p	Microarray	17699775
MIRT005804	hsa-miR-125b-5p	Luciferase reporter assay, qRT-PCR, Western blot	20827722
MIRT019513	hsa-miR-151a-3p	Sequencing	20371350
MIRT026096	hsa-miR-196a-5p	Sequencing	20371350
MIRT032185	hsa-let-7d-5p	Sequencing	20371350
MIRT048544	hsa-miR-100-5p	CLASH	23622248
MIRT046425	hsa-miR-15b-5p	CLASH	23622248
MIRT045709	hsa-miR-125a-5p	CLASH	23622248
MIRT042267	hsa-miR-484	CLASH	23622248
MIRT054676	hsa-miR-26a-5p	SK-MEL-5 and SK-MEL-28)	24056962
MIRT054676	hsa-miR-26a-5p	SK-MEL-5 and SK-MEL-28)	24056962
MIRT054676	hsa-miR-26a-5p	SK-MEL-5 and SK-MEL-28)	24056962
MIRT566935	hsa-miR-379-5p	PAR-CLIP	20371350
MIRT566934	hsa-miR-3529-5p	PAR-CLIP	20371350
MIRT566933	hsa-miR-3133	PAR-CLIP	20371350
MIRT566932	hsa-miR-651-3p	PAR-CLIP	20371350
MIRT566931	hsa-miR-3927-3p	PAR-CLIP	20371350
MIRT566930	hsa-miR-6831-5p	PAR-CLIP	20371350
MIRT566929	hsa-miR-6076	PAR-CLIP	20371350
MIRT566928	hsa-miR-6797-3p	PAR-CLIP	20371350
MIRT566927	hsa-miR-5011-3p	PAR-CLIP	20371350
MIRT566926	hsa-miR-4666b	PAR-CLIP	20371350
MIRT566925	hsa-miR-450b-5p	PAR-CLIP	20371350
MIRT547589	hsa-miR-576-3p	PAR-CLIP	21572407
MIRT556552	hsa-miR-4453	PAR-CLIP	21572407
MIRT556551	hsa-miR-4538	PAR-CLIP	21572407
MIRT547588	hsa-miR-140-5p	PAR-CLIP	21572407
MIRT547587	hsa-miR-335-5p	PAR-CLIP	21572407
MIRT556550	hsa-miR-323a-5p	PAR-CLIP	21572407
MIRT556549	hsa-miR-876-3p	PAR-CLIP	21572407
MIRT547586	hsa-miR-380-5p	PAR-CLIP	21572407
MIRT547585	hsa-miR-563	PAR-CLIP	21572407
MIRT556548	hsa-miR-4536-5p	PAR-CLIP	21572407
MIRT547584	hsa-miR-1273g-5p	PAR-CLIP	21572407
MIRT547583	hsa-miR-8070	PAR-CLIP	21572407
MIRT443422	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT547609	hsa-miR-3163	PAR-CLIP	21572407
MIRT547608	hsa-miR-369-3p	PAR-CLIP	21572407
MIRT547607	hsa-miR-5692b	PAR-CLIP	21572407
MIRT547606	hsa-miR-5692c	PAR-CLIP	21572407
MIRT547605	hsa-miR-410-3p	PAR-CLIP	21572407
MIRT547604	hsa-miR-205-3p	PAR-CLIP	21572407
MIRT547603	hsa-miR-4795-5p	PAR-CLIP	21572407
MIRT547602	hsa-miR-5681b	PAR-CLIP	21572407
MIRT547601	hsa-miR-374a-5p	PAR-CLIP	21572407
MIRT547600	hsa-miR-374b-5p	PAR-CLIP	21572407
MIRT547599	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT547597	hsa-miR-6083	PAR-CLIP	21572407
MIRT547598	hsa-miR-498	PAR-CLIP	21572407
MIRT547595	hsa-miR-4797-5p	PAR-CLIP	21572407
MIRT547596	hsa-miR-3607-3p	PAR-CLIP	21572407
MIRT547594	hsa-miR-1537-5p	PAR-CLIP	21572407
MIRT547592	hsa-miR-4718	PAR-CLIP	21572407
MIRT547593	hsa-miR-4999-5p	PAR-CLIP	21572407
MIRT547591	hsa-miR-6885-3p	PAR-CLIP	21572407
MIRT547590	hsa-miR-2681-5p	PAR-CLIP	21572407
MIRT547589	hsa-miR-576-3p	PAR-CLIP	21572407
MIRT547588	hsa-miR-140-5p	PAR-CLIP	21572407
MIRT547587	hsa-miR-335-5p	PAR-CLIP	21572407
MIRT547586	hsa-miR-380-5p	PAR-CLIP	21572407
MIRT547585	hsa-miR-563	PAR-CLIP	21572407
MIRT547584	hsa-miR-1273g-5p	PAR-CLIP	21572407
MIRT547583	hsa-miR-8070	PAR-CLIP	21572407
MIRT443422	hsa-miR-1277-5p	PAR-CLIP	22100165
MIRT727310	hsa-miR-30a-5p	HITS-CLIP	22473208
MIRT727309	hsa-miR-30b-5p	HITS-CLIP	22473208
MIRT727308	hsa-miR-30c-5p	HITS-CLIP	22473208
MIRT727307	hsa-miR-30d-5p	HITS-CLIP	22473208
MIRT727306	hsa-miR-30e-5p	HITS-CLIP	22473208
MIRT732354	hsa-miR-203a-3p	Luciferase reporter assay, qRT-PCR, Western blot	28218277
MIRT732354	hsa-miR-203a-3p	Luciferase reporter assay, qRT-PCR, Western blot	28218277
MIRT054676	hsa-miR-26a-5p	Luciferase reporter assay, qRT-PCR, Western blot	26787543
MIRT054676	hsa-miR-26a-5p	Luciferase reporter assay, qRT-PCR, Western blot	26787543
MIRT054676	hsa-miR-26a-5p	Luciferase reporter assay, qRT-PCR, Western blot	26787543
MIRT054676	hsa-miR-26a-5p	Luciferase reporter assay, qRT-PCR, Western blot	26787543
MIRT054676	hsa-miR-26a-5p	Luciferase reporter assay, qRT-PCR, Western blot	26787543
MIRT054676	hsa-miR-26a-5p	Luciferase reporter assay, qRT-PCR, Western blot	26787543
MIRT054676	hsa-miR-26a-5p	Luciferase reporter assay, qRT-PCR, Western blot	26787543
MIRT734887	hsa-let-7a-3p	qRT-PCR, Immunocytochemistry (ICC)	33379329
MIRT736230	hsa-miR-152-3p	Luciferase reporter assay, Western blotting, qRT-PCR	31609010
MIRT734887	hsa-let-7a-3p	Western blotting, Immunohistochemistry (IHC), qRT-PCR	32046465
MIRT566935	hsa-miR-379-5p	Luciferase reporter assay, Western blotting, Immunohistochemistry (IHC), RNA-seq, Immunofluorescence, qRT-PCR, In situ hybridization	31907362
MIRT566935	hsa-miR-379-5p	PAR-CLIP	20371350
MIRT566934	hsa-miR-3529-5p	PAR-CLIP	20371350
MIRT566933	hsa-miR-3133	PAR-CLIP	20371350
MIRT566932	hsa-miR-651-3p	PAR-CLIP	20371350
MIRT566931	hsa-miR-3927-3p	PAR-CLIP	20371350
MIRT566930	hsa-miR-6831-5p	PAR-CLIP	20371350
MIRT566929	hsa-miR-6076	PAR-CLIP	20371350
MIRT566928	hsa-miR-6797-3p	PAR-CLIP	20371350
MIRT566927	hsa-miR-5011-3p	PAR-CLIP	20371350
MIRT566926	hsa-miR-4666b	PAR-CLIP	20371350
MIRT566925	hsa-miR-450b-5p	PAR-CLIP	20371350
MIRT547589	hsa-miR-576-3p	PAR-CLIP	21572407
MIRT556552	hsa-miR-4453	PAR-CLIP	21572407
MIRT556551	hsa-miR-4538	PAR-CLIP	21572407
MIRT547588	hsa-miR-140-5p	PAR-CLIP	21572407
MIRT547587	hsa-miR-335-5p	PAR-CLIP	21572407
MIRT556550	hsa-miR-323a-5p	PAR-CLIP	21572407
MIRT556549	hsa-miR-876-3p	PAR-CLIP	21572407
MIRT547586	hsa-miR-380-5p	PAR-CLIP	21572407
MIRT547585	hsa-miR-563	PAR-CLIP	21572407
MIRT556548	hsa-miR-4536-5p	PAR-CLIP	21572407
MIRT547584	hsa-miR-1273g-5p	PAR-CLIP	21572407
MIRT547583	hsa-miR-8070	PAR-CLIP	21572407
MIRT443422	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT547609	hsa-miR-3163	PAR-CLIP	21572407
MIRT547608	hsa-miR-369-3p	PAR-CLIP	21572407
MIRT547607	hsa-miR-5692b	PAR-CLIP	21572407
MIRT547606	hsa-miR-5692c	PAR-CLIP	21572407
MIRT547605	hsa-miR-410-3p	PAR-CLIP	21572407
MIRT547604	hsa-miR-205-3p	PAR-CLIP	21572407
MIRT547603	hsa-miR-4795-5p	PAR-CLIP	21572407
MIRT547602	hsa-miR-5681b	PAR-CLIP	21572407
MIRT547601	hsa-miR-374a-5p	PAR-CLIP	21572407
MIRT547600	hsa-miR-374b-5p	PAR-CLIP	21572407
MIRT547599	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT547597	hsa-miR-6083	PAR-CLIP	21572407
MIRT547598	hsa-miR-498	PAR-CLIP	21572407
MIRT547595	hsa-miR-4797-5p	PAR-CLIP	21572407
MIRT547596	hsa-miR-3607-3p	PAR-CLIP	21572407
MIRT547594	hsa-miR-1537-5p	PAR-CLIP	21572407
MIRT547592	hsa-miR-4718	PAR-CLIP	21572407
MIRT547593	hsa-miR-4999-5p	PAR-CLIP	21572407
MIRT547591	hsa-miR-6885-3p	PAR-CLIP	21572407
MIRT547590	hsa-miR-2681-5p	PAR-CLIP	21572407
MIRT547589	hsa-miR-576-3p	PAR-CLIP	21572407
MIRT547588	hsa-miR-140-5p	PAR-CLIP	21572407
MIRT547587	hsa-miR-335-5p	PAR-CLIP	21572407
MIRT547586	hsa-miR-380-5p	PAR-CLIP	21572407
MIRT547585	hsa-miR-563	PAR-CLIP	21572407
MIRT547584	hsa-miR-1273g-5p	PAR-CLIP	21572407
MIRT547583	hsa-miR-8070	PAR-CLIP	21572407
MIRT443422	hsa-miR-1277-5p	PAR-CLIP	22100165
MIRT756034	hsa-miR-99b-5p	Luciferase reporter assay, Western blotting, qRT-PCR, Immunohistochemistry (IHC), RNA-seq	34998954
MIRT1110149	hsa-miR-101	CLIP-seq
MIRT1110150	hsa-miR-1229	CLIP-seq
MIRT1110151	hsa-miR-1253	CLIP-seq
MIRT1110152	hsa-miR-128	CLIP-seq
MIRT1110153	hsa-miR-1297	CLIP-seq
MIRT1110154	hsa-miR-1305	CLIP-seq
MIRT1110155	hsa-miR-144	CLIP-seq
MIRT1110156	hsa-miR-1827	CLIP-seq
MIRT1110157	hsa-miR-199a-3p	CLIP-seq
MIRT1110158	hsa-miR-199b-3p	CLIP-seq
MIRT1110159	hsa-miR-200b	CLIP-seq
MIRT1110160	hsa-miR-200c	CLIP-seq
MIRT1110161	hsa-miR-205	CLIP-seq
MIRT1110162	hsa-miR-218	CLIP-seq
MIRT1110163	hsa-miR-219-1-3p	CLIP-seq
MIRT1110164	hsa-miR-23a	CLIP-seq
MIRT1110165	hsa-miR-23b	CLIP-seq
MIRT1110166	hsa-miR-23c	CLIP-seq
MIRT1110167	hsa-miR-26a	CLIP-seq
MIRT1110168	hsa-miR-26b	CLIP-seq
MIRT1110169	hsa-miR-27a	CLIP-seq
MIRT1110170	hsa-miR-27b	CLIP-seq
MIRT1110171	hsa-miR-3127-3p	CLIP-seq
MIRT1110172	hsa-miR-3129-5p	CLIP-seq
MIRT1110173	hsa-miR-3145-3p	CLIP-seq
MIRT1110174	hsa-miR-3145-5p	CLIP-seq
MIRT1110175	hsa-miR-3155	CLIP-seq
MIRT1110176	hsa-miR-3155b	CLIP-seq
MIRT1110177	hsa-miR-3173-3p	CLIP-seq
MIRT1110178	hsa-miR-329	CLIP-seq
MIRT1110179	hsa-miR-342-3p	CLIP-seq
MIRT1110180	hsa-miR-3617	CLIP-seq
MIRT1110181	hsa-miR-362-3p	CLIP-seq
MIRT1110182	hsa-miR-3650	CLIP-seq
MIRT1110183	hsa-miR-3682-5p	CLIP-seq
MIRT1110184	hsa-miR-3689a-5p	CLIP-seq
MIRT1110185	hsa-miR-3689b	CLIP-seq
MIRT1110186	hsa-miR-3689e	CLIP-seq
MIRT1110187	hsa-miR-3689f	CLIP-seq
MIRT1110188	hsa-miR-3941	CLIP-seq
MIRT1110189	hsa-miR-3977	CLIP-seq
MIRT1110190	hsa-miR-4276	CLIP-seq
MIRT1110191	hsa-miR-4287	CLIP-seq
MIRT1110192	hsa-miR-429	CLIP-seq
MIRT1110193	hsa-miR-4292	CLIP-seq
MIRT1110194	hsa-miR-4308	CLIP-seq
MIRT1110195	hsa-miR-4428	CLIP-seq
MIRT1110196	hsa-miR-4455	CLIP-seq
MIRT1110197	hsa-miR-4465	CLIP-seq
MIRT1110198	hsa-miR-4469	CLIP-seq
MIRT1110199	hsa-miR-4649-3p	CLIP-seq
MIRT1110200	hsa-miR-4685-3p	CLIP-seq
MIRT1110201	hsa-miR-4699-5p	CLIP-seq
MIRT1110202	hsa-miR-4712-3p	CLIP-seq
MIRT1110203	hsa-miR-4713-5p	CLIP-seq
MIRT1110204	hsa-miR-4717-3p	CLIP-seq
MIRT1110205	hsa-miR-4753-3p	CLIP-seq
MIRT1110206	hsa-miR-4756-3p	CLIP-seq
MIRT1110207	hsa-miR-4768-5p	CLIP-seq
MIRT1110208	hsa-miR-4775	CLIP-seq
MIRT1110209	hsa-miR-4779	CLIP-seq
MIRT1110210	hsa-miR-501-3p	CLIP-seq
MIRT1110211	hsa-miR-502-3p	CLIP-seq
MIRT1110212	hsa-miR-508-5p	CLIP-seq
MIRT1110213	hsa-miR-510	CLIP-seq
MIRT1110214	hsa-miR-511	CLIP-seq
MIRT1110215	hsa-miR-520a-5p	CLIP-seq
MIRT1110216	hsa-miR-525-5p	CLIP-seq
MIRT1110217	hsa-miR-544b	CLIP-seq
MIRT1110218	hsa-miR-548ac	CLIP-seq
MIRT1110219	hsa-miR-548ae	CLIP-seq
MIRT1110220	hsa-miR-548aj	CLIP-seq
MIRT1110221	hsa-miR-548am	CLIP-seq
MIRT1110222	hsa-miR-548d-3p	CLIP-seq
MIRT1110223	hsa-miR-548x	CLIP-seq
MIRT1110224	hsa-miR-548z	CLIP-seq
MIRT1110225	hsa-miR-579	CLIP-seq
MIRT1110226	hsa-miR-582-5p	CLIP-seq
MIRT1110227	hsa-miR-583	CLIP-seq
MIRT1110228	hsa-miR-587	CLIP-seq
MIRT1110229	hsa-miR-590-3p	CLIP-seq
MIRT1110230	hsa-miR-603	CLIP-seq
MIRT1110231	hsa-miR-629	CLIP-seq
MIRT1110232	hsa-miR-636	CLIP-seq
MIRT1110233	hsa-miR-641	CLIP-seq
MIRT1110234	hsa-miR-936	CLIP-seq
MIRT1922218	hsa-miR-1206	CLIP-seq
MIRT1922219	hsa-miR-4793-5p	CLIP-seq
MIRT1922220	hsa-miR-486-5p	CLIP-seq
MIRT2030679	hsa-let-7a	CLIP-seq
MIRT2030680	hsa-let-7b	CLIP-seq
MIRT2030681	hsa-let-7c	CLIP-seq
MIRT2030682	hsa-let-7d	CLIP-seq
MIRT2030683	hsa-let-7e	CLIP-seq
MIRT2030684	hsa-let-7f	CLIP-seq
MIRT2030685	hsa-let-7g	CLIP-seq
MIRT2030686	hsa-let-7i	CLIP-seq
MIRT1110150	hsa-miR-1229	CLIP-seq
MIRT2030687	hsa-miR-1303	CLIP-seq
MIRT1110164	hsa-miR-23a	CLIP-seq
MIRT1110165	hsa-miR-23b	CLIP-seq
MIRT1110166	hsa-miR-23c	CLIP-seq
MIRT2030688	hsa-miR-3125	CLIP-seq
MIRT2030689	hsa-miR-3591-3p	CLIP-seq
MIRT2030690	hsa-miR-3609	CLIP-seq
MIRT2030691	hsa-miR-377	CLIP-seq
MIRT2030692	hsa-miR-3916	CLIP-seq
MIRT1110189	hsa-miR-3977	CLIP-seq
MIRT2030693	hsa-miR-4458	CLIP-seq
MIRT2030694	hsa-miR-4500	CLIP-seq
MIRT2030695	hsa-miR-4639-3p	CLIP-seq
MIRT1110204	hsa-miR-4717-3p	CLIP-seq
MIRT2030696	hsa-miR-5096	CLIP-seq
MIRT2030697	hsa-miR-518a-5p	CLIP-seq
MIRT2030698	hsa-miR-520g	CLIP-seq
MIRT2030699	hsa-miR-520h	CLIP-seq
MIRT2030700	hsa-miR-527	CLIP-seq
MIRT1110218	hsa-miR-548ac	CLIP-seq
MIRT1110219	hsa-miR-548ae	CLIP-seq
MIRT2030701	hsa-miR-548ag	CLIP-seq
MIRT2030702	hsa-miR-548ah	CLIP-seq
MIRT2030703	hsa-miR-548ai	CLIP-seq
MIRT1110220	hsa-miR-548aj	CLIP-seq
MIRT1110221	hsa-miR-548am	CLIP-seq
MIRT1110222	hsa-miR-548d-3p	CLIP-seq
MIRT2030704	hsa-miR-548m	CLIP-seq
MIRT1110223	hsa-miR-548x	CLIP-seq
MIRT1110224	hsa-miR-548z	CLIP-seq
MIRT2030705	hsa-miR-659	CLIP-seq
MIRT2030706	hsa-miR-877	CLIP-seq
MIRT2030707	hsa-miR-9	CLIP-seq
MIRT2030708	hsa-miR-98	CLIP-seq
MIRT2030679	hsa-let-7a	CLIP-seq
MIRT2030680	hsa-let-7b	CLIP-seq
MIRT2030681	hsa-let-7c	CLIP-seq
MIRT2030682	hsa-let-7d	CLIP-seq
MIRT2030683	hsa-let-7e	CLIP-seq
MIRT2030684	hsa-let-7f	CLIP-seq
MIRT2030685	hsa-let-7g	CLIP-seq
MIRT2030686	hsa-let-7i	CLIP-seq
MIRT1922218	hsa-miR-1206	CLIP-seq
MIRT2030687	hsa-miR-1303	CLIP-seq
MIRT1110154	hsa-miR-1305	CLIP-seq
MIRT2261384	hsa-miR-202	CLIP-seq
MIRT1110164	hsa-miR-23a	CLIP-seq
MIRT1110165	hsa-miR-23b	CLIP-seq
MIRT1110166	hsa-miR-23c	CLIP-seq
MIRT2261385	hsa-miR-30a	CLIP-seq
MIRT2261386	hsa-miR-30b	CLIP-seq
MIRT2261387	hsa-miR-30c	CLIP-seq
MIRT2261388	hsa-miR-30d	CLIP-seq
MIRT2261389	hsa-miR-30e	CLIP-seq
MIRT2261390	hsa-miR-3123	CLIP-seq
MIRT2261391	hsa-miR-3529	CLIP-seq
MIRT2030690	hsa-miR-3609	CLIP-seq
MIRT2261392	hsa-miR-3613-3p	CLIP-seq
MIRT2261393	hsa-miR-379	CLIP-seq
MIRT2261394	hsa-miR-3925-5p	CLIP-seq
MIRT2261395	hsa-miR-3927	CLIP-seq
MIRT1110189	hsa-miR-3977	CLIP-seq
MIRT2030693	hsa-miR-4458	CLIP-seq
MIRT2030694	hsa-miR-4500	CLIP-seq
MIRT1110204	hsa-miR-4717-3p	CLIP-seq
MIRT2261396	hsa-miR-4733-5p	CLIP-seq
MIRT2261397	hsa-miR-494	CLIP-seq
MIRT2030698	hsa-miR-520g	CLIP-seq
MIRT2030699	hsa-miR-520h	CLIP-seq
MIRT2030702	hsa-miR-548ah	CLIP-seq
MIRT2261398	hsa-miR-570	CLIP-seq
MIRT2261399	hsa-miR-577	CLIP-seq
MIRT2030708	hsa-miR-98	CLIP-seq
MIRT2390157	hsa-miR-320e	CLIP-seq
MIRT1110179	hsa-miR-342-3p	CLIP-seq
MIRT2390158	hsa-miR-380	CLIP-seq
MIRT2390159	hsa-miR-4457	CLIP-seq
MIRT2390160	hsa-miR-4490	CLIP-seq
MIRT2390161	hsa-miR-4495	CLIP-seq
MIRT2390162	hsa-miR-513b	CLIP-seq
MIRT2390163	hsa-miR-618	CLIP-seq
MIRT1110154	hsa-miR-1305	CLIP-seq
MIRT2453063	hsa-miR-3164	CLIP-seq
MIRT2030690	hsa-miR-3609	CLIP-seq
MIRT2453064	hsa-miR-3973	CLIP-seq
MIRT2453065	hsa-miR-4452	CLIP-seq
MIRT2030698	hsa-miR-520g	CLIP-seq
MIRT2030699	hsa-miR-520h	CLIP-seq
MIRT2030702	hsa-miR-548ah	CLIP-seq
MIRT2453066	hsa-miR-607	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
TBP	Activation	23494474

Show/Hide all(31)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003676	Function	Nucleic acid binding	IEA
GO:0003723	Function	RNA binding	HDA	22681889
GO:0003723	Function	RNA binding	IDA	19703396
GO:0003723	Function	RNA binding	IEA
GO:0003729	Function	MRNA binding	IBA
GO:0005515	Function	Protein binding	IPI	19703396
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005730	Component	Nucleolus	IDA
GO:0005730	Component	Nucleolus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0008270	Function	Zinc ion binding	IEA
GO:0010587	Process	MiRNA catabolic process	IEA
GO:0010587	Process	MiRNA catabolic process	IMP	19703396
GO:0010608	Process	Post-transcriptional regulation of gene expression	IEA
GO:0031047	Process	Regulatory ncRNA-mediated gene silencing	IEA
GO:0031054	Process	Pre-miRNA processing	IBA
GO:0031054	Process	Pre-miRNA processing	IEA
GO:0031054	Process	Pre-miRNA processing	IMP	19703396
GO:0031123	Process	RNA 3'-end processing	IEA
GO:0031123	Process	RNA 3'-end processing	IMP	19703396
GO:0046872	Function	Metal ion binding	IEA
GO:0050779	Process	RNA destabilization	IDA	18951094
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:2000627	Process	Positive regulation of miRNA catabolic process	IMP	18951094
GO:2000632	Process	Negative regulation of pre-miRNA processing	IDA	18951094
GO:2000632	Process	Negative regulation of pre-miRNA processing	IEA
GO:2000635	Process	Negative regulation of primary miRNA processing	IDA	18951094

MIM	HGNC	e!Ensembl
611044	32207	ENSG00000187772

Protein

UniProt ID

Q6ZN17

Protein name

Protein lin-28 homolog B (Lin-28B)

Protein function

Suppressor of microRNA (miRNA) biogenesis, including that of let-7 and possibly of miR107, miR-143 and miR-200c. Binds primary let-7 transcripts (pri-let-7), including pri-let-7g and pri-let-7a-1, and sequester them in the nucleolus, away from t

PDB

4A4I

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00313	CSD	30 → 102		Domain
PF00098	zf-CCHC	127 → 144	Zinc knuckle	Domain
PF00098	zf-CCHC	149 → 166	Zinc knuckle	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed at high levels in the placenta and, at mucher lower, in testis and fetal liver (PubMed:16971064). Isoform 1 is only detected in placenta and in moderately and poorly differentiated hepatocellular carcinoma cells (at protein l

Sequence

MAEGGASKGGGEEPGKLPEPAEEESQVLRGTGHCKWFNVRMGFGFISMINREGSPLDIPV
DVFVHQSKLFMEGFRSLKEGEPVEFTFKKSSKGLESIRVTGPGGSPCLGSERRPKGKTLQ
KRKPKGDRCYNCGGLDHHAKECSLPPQPKKCHYCQSIMHMVANCPHKNVAQPPASSQGRQ
EAESQPCTSTLPREVGGGHGCTSPPFPQEARAEISERSGRSPQEASSTKSSIAPEEQSKK
GPSVQKRKKT

Sequence length

250

Interactions

View interactions

Show/Hide Unknown Diseases (6)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Hypogonadism	Hypogonadism	N/A	N/A	GWAS
Insomnia	Insomnia	N/A	N/A	GWAS
Mental Depression	Major depressive disorder	N/A	N/A	GWAS
Neuroblastoma	Neuroblastoma	N/A	N/A	GWAS
Neuroticism	Neuroticism	N/A	N/A	GWAS
Schizophrenia	Schizophrenia	N/A	N/A	GWAS

Show/Hide Text Mining Associations (70)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Abortion Habitual	Associate	35118391
Adenocarcinoma of Lung	Associate	29301498
Aortic Aneurysm Abdominal	Associate	37822152
Breast Neoplasms	Associate	24885919, 31907362
Burkitt Lymphoma	Associate	26325594
Calcinosis Cutis	Associate	34779407
Carcinogenesis	Associate	22225612, 24885919, 26080928, 26123663, 26481147, 29330293
Carcinoma Ductal Breast	Associate	24885919
Carcinoma Hepatocellular	Associate	24244607, 26080928, 29466730, 32571380, 33228611, 37269361
Carcinoma Non Small Cell Lung	Associate	22225612, 24780874, 25277326, 25368430
Carcinoma Ovarian Epithelial	Associate	26158423
Cholangiocarcinoma	Associate	34548635, 34837926
Choriocarcinoma	Associate	30958882
Colonic Diseases	Associate	25360631
Colonic Neoplasms	Stimulate	21625210
Colorectal Neoplasms	Associate	21625210, 23052130, 25360631, 27793004, 29330293, 31510013, 32828126
Coronary Artery Disease	Associate	26305337
Cytokine Release Syndrome	Stimulate	34837926
Depressive Disorder Major	Associate	29724816
Disease	Associate	35273655
Drug Related Side Effects and Adverse Reactions	Associate	25360631
Fetal Growth Retardation	Associate	31415216
Fibrosis	Associate	32571380
Hemihyperplasia Isolated	Associate	29724816
Hepatitis B Chronic	Associate	32571380
Hepatitis Chronic	Associate	32571380
Hepatoblastoma	Associate	29507645
Hypersensitivity Delayed	Associate	22882789
Hypoglycemia	Associate	36828304
Inflammation	Associate	32571380, 34837926
Leiomyoma	Associate	35689443
Leukemia Myeloid Acute	Associate	34793513
Leukemia Myelomonocytic Juvenile	Associate	26712910
Lung Neoplasms	Associate	19745602, 28218277, 28603287, 29950144, 31766078, 37269361
Lymphatic Metastasis	Stimulate	22433967
Lymphatic Metastasis	Associate	36999462
Lymphoma Non Hodgkin	Associate	38019245
Medulloblastoma	Associate	37083768
Melanoma	Associate	28482074, 34424910
Mouth Neoplasms	Associate	25503985
Mouth Neoplasms	Inhibit	25503985
Multiple Myeloma	Associate	36059274
Neoplasm Metastasis	Associate	31510013, 32627014, 34548635, 34779407, 38019245
Neoplasms	Associate	21625210, 22118463, 23129384, 24244607, 25197381, 25301052, 26080928, 26917013, 27184842, 28218277, 29301498, 29330293, 29466730, 30615673, 31147574 View all (8 more)
Neoplasms	Stimulate	22433967, 24885919, 25360631, 28482074, 31379107, 34837926
Neoplasms	Inhibit	26997273, 29970131
Neoplasms Adipose Tissue	Associate	23152804
Neuroblastoma	Associate	19495417, 22941191, 23222812, 25312269, 26123663, 26481147, 27021521, 30375995, 32707690, 34779407, 34998954, 37991019
Neuroectodermal Tumors Primitive	Associate	24839957
Obesity	Associate	20962026
Oncogene Addiction	Associate	27793004
Osteosarcoma	Associate	23129384
Ovarian Neoplasms	Associate	21533284, 25188517, 26158423, 30154460, 32627014, 36495291
Pancreatic Neoplasms	Stimulate	33107691
Papilloma Choroid Plexus	Associate	36828304
Polyps	Associate	35273655
Prostatic Neoplasms	Associate	25201220, 35983819
Prostatic Neoplasms Castration Resistant	Associate	25201220, 28910332
Prostatitis	Associate	25201220
Puberty Precocious	Associate	22964795, 30053798
Radiation Pneumonitis	Associate	24780874
Sarcoma	Associate	31147574
Squamous Cell Carcinoma of Head and Neck	Associate	28381191, 36999462
Stomach Neoplasms	Associate	25197381, 29970131
Teratozoospermia	Associate	25762640
Triple Negative Breast Neoplasms	Associate	22118463, 35711895
Urinary Bladder Neoplasms	Associate	33516780
Uterine Diseases	Associate	35273655
Wilms Tumor	Stimulate	28301057
Wilms Tumor	Associate	28301057, 28825729

LIN28B (lin-28 RNA binding posttranscriptional regulator B)