PSMG4 (proteasome assembly chaperone 4)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
389362
Gene name Gene Name - the full gene name approved by the HGNC.
Proteasome assembly chaperone 4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PSMG4
Synonyms (NCBI Gene) Gene synonyms aliases
C6orf86, PAC4, Pba4, bA506K6.2
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6p25.2
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(6)
miRTarBase ID miRNA Experiments Reference
MIRT052258 hsa-let-7b-5p CLASH 23622248
MIRT035828 hsa-miR-1292-5p CLASH 23622248
MIRT1271072 hsa-miR-1229 CLIP-seq
MIRT1271073 hsa-miR-4699-3p CLIP-seq
MIRT1271074 hsa-miR-520d-5p CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(3)
GO ID Ontology Definition Evidence Reference
GO:0032991 Component Protein-containing complex ISS 17707236
GO:0043248 Process Proteasome assembly IEA
GO:0044877 Function Protein-containing complex binding ISS 17707236
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
617550 21108 ENSG00000180822
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Q5JS54
Protein name Proteasome assembly chaperone 4 (PAC-4) (hPAC4) (Proteasome chaperone homolog 4) (Pba4)
Protein function Chaperone protein which promotes assembly of the 20S proteasome.
PDB 5WTQ , 8QYJ , 8TM3
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF16093 PAC4 25 → 97 Proteasome assembly chaperone 4 Family
Sequence 
MEGLVVAAGGDVSLHNFSARLWEQLVHFHVMRLTDSLFLWVGATPHLRNLAVAMCSRYDS
IPVSTSLLGDTSDTTSTGLAQRLARKTNKQVFVSYNLQNTDSNFALLVENRIKEEMEAFP
EKF
Sequence length 123
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Inflammatory bowel disease Inflammatory Bowel Diseases rs137853579, rs137853580, rs121909601, rs149491038, rs368287711, rs387907326, rs587777338, rs758439420, rs1329427406, rs1264862631, rs1192830343, rs1373354533, rs1419560997, rs1591263883, rs1989014468 29603369
Show/Hide Unknown Diseases (1)
Unknown
Disease term Disease name Evidence References Source
Biliary Cholangitis Biliary Cholangitis GWAS
Show/Hide Text Mining Associations (2)
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 36619227
Lung Neoplasms Stimulate 36619227