PSMG4 (proteasome assembly chaperone 4)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein
Entrez ID 389362
Gene name Proteasome assembly chaperone 4
Gene symbol PSMG4
Synonyms (NCBI Gene)
C6orf86PAC4Pba4bA506K6.2
Chromosome 6
Chromosome location 6p25.2
miRNA miRNA information provided by mirtarbase database.
6
Gene miRNA Gene ontology Other IDs Protein
Show/Hide all (6)
miRTarBase ID miRNA Experiments Reference
MIRT052258 hsa-let-7b-5p CLASH 23622248
MIRT035828 hsa-miR-1292-5p CLASH 23622248
MIRT1271072 hsa-miR-1229 CLIP-seq
MIRT1271073 hsa-miR-4699-3p CLIP-seq
MIRT1271074 hsa-miR-520d-5p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
6
Gene miRNA Gene ontology Other IDs Protein
Show/Hide all (6)
GO ID Ontology Definition Evidence Reference
GO:0005829 Component Cytosol TAS
GO:0032991 Component Protein-containing complex IEA
GO:0032991 Component Protein-containing complex ISS 17707236
GO:0043248 Process Proteasome assembly IEA
GO:0044877 Function Protein-containing complex binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein
MIM HGNC e!Ensembl
617550 21108 ENSG00000180822
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q5JS54
Protein name Proteasome assembly chaperone 4 (PAC-4) (hPAC4) (Proteasome chaperone homolog 4) (Pba4)
Protein function Chaperone protein which promotes assembly of the 20S proteasome.
PDB 5WTQ , 8QYJ , 8TM3
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF16093 PAC4 25 → 97 Proteasome assembly chaperone 4 Family
Sequence 
MEGLVVAAGGDVSLHNFSARLWEQLVHFHVMRLTDSLFLWVGATPHLRNLAVAMCSRYDS
IPVSTSLLGDTSDTTSTGLAQRLARKTNKQVFVSYNLQNTDSNFALLVENRIKEEMEAFP
EKF
Sequence length 123
Interactions View interactions