Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
389136
Gene name Gene Name - the full gene name approved by the HGNC.
Vestigial like family member 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
VGLL3
Synonyms (NCBI Gene) Gene synonyms aliases
VGL-3, VGL3
Chromosome Chromosome number
3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
3p12.1
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT026549 hsa-miR-192-5p Microarray 19074876
MIRT027671 hsa-miR-98-5p Microarray 19088304
MIRT030546 hsa-miR-24-3p Sequencing 20138800
MIRT651717 hsa-miR-508-5p HITS-CLIP 23824327
MIRT651716 hsa-miR-4293 HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005634 Component Nucleus IBA 21873635
GO:0006357 Process Regulation of transcription by RNA polymerase II IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
609980 24327 ENSG00000206538
Protein
UniProt ID A8MV65
Protein name Transcription cofactor vestigial-like protein 3 (Vgl-3)
Protein function May act as a specific coactivator for the mammalian TEFs.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07545 Vg_Tdu 82 112 Vestigial/Tondu family Family
Tissue specificity TISSUE SPECIFICITY: Enriched in placenta. {ECO:0000269|PubMed:12376544}.
Sequence
MSCAEVMYHPQPYGASQYLPNPMAATTCPTAYYQPAPQPGQQKKLAVFSKMQDSLEVTLP
SKQEEEDEEEEEEEKDQPAEMEYLNSRCVLFTYFQGDIGSVVDEHFSRALGQAITLHPES
AISKSKMGLTPLWRDSSALSSQRNSFPTSFWTSSYQPPPAPCLGGVHPDFQVTGPPGTFS
AADPSPWPGHNLHQTGPAPPPAVSESWPYPLTSQVSPSYSHMHDVYMRHHHPHAHMHHRH
RHHHHHHHPPAGSALDPSYGPLLMPSVHAARIPAPQCDITKTEPTTVTSATSAWAGAFHG
TVDIVPSVGFDTGLQHQDKSKESPWY
Sequence length 326
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Breast carcinoma Breast Carcinoma rs80359671, rs11540652, rs28934575, rs28897672, rs137886232, rs193922376, rs80357783, rs80359306, rs80359405, rs80359507, rs80359598, rs80358429, rs397507683, rs397515636, rs80359451
View all (71 more)
29059683
Unknown
Disease term Disease name Evidence References Source
Diabetes Diabetes GWAS
Breast Cancer Breast Cancer Importantly, breast cancer patients bearing PRC2 LOF mutations displayed significantly worse prognosis compared with PRC2 wild-type patients GWAS, CBGDA
Prostate cancer Prostate cancer Together, these results show that PRRX2 is an oncogene and might play a role in the aggressiveness of PC within the DNPC population. GWAS, CBGDA
Associations from Text Mining
Disease Name Relationship Type References
Arthritis Rheumatoid Associate 35941675
Autoimmune Diseases Associate 27992404, 32803756
Breast Neoplasms Associate 32385107, 35217640
Carcinoma Associate 35766997
Inflammation Associate 27992404, 32803756
Insulin Resistance Associate 39277575
Lupus Erythematosus Cutaneous Associate 27992404
Lupus Erythematosus Systemic Associate 27992404, 32803756
Neoplasms Associate 31992826, 32385107, 33649458, 35766997
Neoplasms Adipose Tissue Stimulate 39277575