Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	389073
Gene name Gene Name - the full gene name approved by the HGNC.	Chromosome 2 open reading frame 80
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	C2orf80
Synonyms (NCBI Gene) Gene synonyms aliases	GONDA1
Chromosome Chromosome number	2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	2q33.3

Show/Hide all(21)

miRTarBase ID	miRNA	Experiments
MIRT846429	hsa-miR-1208	CLIP-seq
MIRT846430	hsa-miR-1273g	CLIP-seq
MIRT846431	hsa-miR-145	CLIP-seq
MIRT846432	hsa-miR-19a	CLIP-seq
MIRT846433	hsa-miR-19b	CLIP-seq
MIRT846434	hsa-miR-31	CLIP-seq
MIRT846435	hsa-miR-335	CLIP-seq
MIRT846436	hsa-miR-338-3p	CLIP-seq
MIRT846437	hsa-miR-3658	CLIP-seq
MIRT846438	hsa-miR-3925-3p	CLIP-seq
MIRT846439	hsa-miR-4272	CLIP-seq
MIRT846440	hsa-miR-4274	CLIP-seq
MIRT846441	hsa-miR-4426	CLIP-seq
MIRT846442	hsa-miR-4427	CLIP-seq
MIRT846443	hsa-miR-4452	CLIP-seq
MIRT846444	hsa-miR-4530	CLIP-seq
MIRT846445	hsa-miR-4647	CLIP-seq
MIRT846446	hsa-miR-4662b	CLIP-seq
MIRT846447	hsa-miR-4680-3p	CLIP-seq
MIRT846448	hsa-miR-515-5p	CLIP-seq
MIRT846449	hsa-miR-766	CLIP-seq

MIM	HGNC	e!Ensembl
615536	34352	ENSG00000188674

Protein

UniProt ID

Q0P641

Protein name

Uncharacterized protein C2orf80

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF17718	DUF5563	1 → 192	Family of unknown function (DUF5563)	Family

Sequence

MERRLIKKEMKKLLGDYIGIRLRENEFDPKGRRQLTFLDDMAHYDLAISVALQWLDPSED
LTWLEWEELKIPLHGRPIYPNRREREAMILSSYAGILMNSIPIEEVFKIYGADSSADSGT
IKVPRVSSLCLSLHPFAMLTAPKAAAYARKQSVKSRKVTTNKNATSISAKEANATEWKSS
QRFSDTQPKHKVT

Sequence length

193

Interactions

View interactions

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Glioma	Glioma	N/A	N/A	GWAS

Show/Hide Text Mining Associations (2)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Glioma	Stimulate	36541697
Gonadal Dysgenesis 46 XY	Associate	24055526

C2orf80 (chromosome 2 open reading frame 80)