Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	389058
Gene name Gene Name - the full gene name approved by the HGNC.	Sp5 transcription factor
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	SP5
Synonyms (NCBI Gene) Gene synonyms aliases	-
Chromosome Chromosome number	2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	2q31.1

Show/Hide all(52)

miRTarBase ID	miRNA	Experiments
MIRT1381507	hsa-miR-103a	CLIP-seq
MIRT1381508	hsa-miR-107	CLIP-seq
MIRT1381509	hsa-miR-125a-5p	CLIP-seq
MIRT1381510	hsa-miR-125b	CLIP-seq
MIRT1381511	hsa-miR-1293	CLIP-seq
MIRT1381512	hsa-miR-142-3p	CLIP-seq
MIRT1381513	hsa-miR-15a	CLIP-seq
MIRT1381514	hsa-miR-15b	CLIP-seq
MIRT1381515	hsa-miR-16	CLIP-seq
MIRT1381516	hsa-miR-193a-5p	CLIP-seq
MIRT1381517	hsa-miR-195	CLIP-seq
MIRT1381518	hsa-miR-214	CLIP-seq
MIRT1381519	hsa-miR-300	CLIP-seq
MIRT1381520	hsa-miR-3179	CLIP-seq
MIRT1381521	hsa-miR-3202	CLIP-seq
MIRT1381522	hsa-miR-323-5p	CLIP-seq
MIRT1381523	hsa-miR-337-3p	CLIP-seq
MIRT1381524	hsa-miR-3619-5p	CLIP-seq
MIRT1381525	hsa-miR-3685	CLIP-seq
MIRT1381526	hsa-miR-381	CLIP-seq
MIRT1381527	hsa-miR-384	CLIP-seq
MIRT1381528	hsa-miR-3922-5p	CLIP-seq
MIRT1381529	hsa-miR-424	CLIP-seq
MIRT1381530	hsa-miR-4277	CLIP-seq
MIRT1381531	hsa-miR-4281	CLIP-seq
MIRT1381532	hsa-miR-4291	CLIP-seq
MIRT1381533	hsa-miR-4310	CLIP-seq
MIRT1381534	hsa-miR-4319	CLIP-seq
MIRT1381535	hsa-miR-4483	CLIP-seq
MIRT1381536	hsa-miR-4497	CLIP-seq
MIRT1381537	hsa-miR-4666-3p	CLIP-seq
MIRT1381538	hsa-miR-4728-5p	CLIP-seq
MIRT1381539	hsa-miR-4738-3p	CLIP-seq
MIRT1381540	hsa-miR-4747-5p	CLIP-seq
MIRT1381541	hsa-miR-4753-5p	CLIP-seq
MIRT1381542	hsa-miR-486-5p	CLIP-seq
MIRT1381543	hsa-miR-497	CLIP-seq
MIRT1381544	hsa-miR-548g	CLIP-seq
MIRT1381545	hsa-miR-615-5p	CLIP-seq
MIRT1381546	hsa-miR-624	CLIP-seq
MIRT1381547	hsa-miR-761	CLIP-seq
MIRT1381548	hsa-miR-922	CLIP-seq
MIRT2114183	hsa-miR-4772-3p	CLIP-seq
MIRT2114184	hsa-miR-891b	CLIP-seq
MIRT1381509	hsa-miR-125a-5p	CLIP-seq
MIRT1381510	hsa-miR-125b	CLIP-seq
MIRT2337107	hsa-miR-4287	CLIP-seq
MIRT1381534	hsa-miR-4319	CLIP-seq
MIRT2337108	hsa-miR-4469	CLIP-seq
MIRT2337109	hsa-miR-4685-3p	CLIP-seq
MIRT2337110	hsa-miR-4732-3p	CLIP-seq
MIRT2337111	hsa-miR-670	CLIP-seq

Show/Hide all(15)

GO ID	Ontology	Definition	Evidence
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000785	Component	Chromatin	ISA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IEA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IEA
GO:0003677	Function	DNA binding	IEA
GO:0005634	Component	Nucleus	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0008270	Function	Zinc ion binding	IEA
GO:0036342	Process	Post-anal tail morphogenesis	IEA
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0060349	Process	Bone morphogenesis	IEA

MIM	HGNC	e!Ensembl
609391	14529	ENSG00000204335

Protein

UniProt ID

Q6BEB4

Protein name

Transcription factor Sp5

Protein function

Binds to GC boxes promoters elements. Probable transcriptional activator that has a role in the coordination of changes in transcription required to generate pattern in the developing embryo (By similarity).

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00096	zf-C2H2	296 → 320	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	326 → 350	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	356 → 378	Zinc finger, C2H2 type	Domain

Sequence

MAAVAVLRNDSLQAFLQDRTPSASPDLGKHSPLALLAATCSRIGQPGAAAPPDFLQVPYD
PALGSPSRLFHPWTADMPAHSPGALPPPHPSLGLTPQKTHLQPSFGAAHELPLTPPADPS
YPYEFSPVKMLPSSMAALPASCAPAYVPYAAQAALPPGYSNLLPPPPPPPPPPTCRQLSP
NPAPDDLPWWSIPQAGAGPGASGVPGSGLSGACAGAPHAPRFPASAAAAAAAAAALQRGL
VLGPSDFAQYQSQIAALLQTKAPLAATARRCRRCRCPNCQAAGGAPEAEPGKKKQHVCHV
PGCGKVYGKTSHLKAHLRWHTGERPFVCNWLFCGKSFTRSDELQRHLRTHTGEKRFACPE
CGKRFMRSDHLAKHVKTHQNKKLKVAEAGVKREDARDL

Sequence length

398

Interactions

View interactions

SP5 (Sp5 transcription factor)