Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID	388585
Gene name	Hes family bHLH transcription factor 5
Gene symbol	HES5
Synonyms (NCBI Gene)	bHLHb38
Chromosome	1
Chromosome location	1p36.32
Summary	This gene encodes a member of a family of basic helix-loop-helix transcriptional repressors. The protein product of this gene, which is activated downstream of the Notch pathway, regulates cell differentiation in multiple tissues. Disruptions in the norma

Show/Hide all (2)

miRTarBase ID	miRNA	Experiments	Reference
MIRT439161	hsa-let-7c-5p	3'LIFE	25074381
MIRT439161	hsa-let-7c-5p	3'LIFE	25074381

Show/Hide all (94)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	ISS
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IEA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	ISS
GO:0002062	Process	Chondrocyte differentiation	ISS
GO:0003677	Function	DNA binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0007155	Process	Cell adhesion	IEA
GO:0007155	Process	Cell adhesion	ISS
GO:0007219	Process	Notch signaling pathway	IEA
GO:0007219	Process	Notch signaling pathway	IMP	19682396, 19855400
GO:0007224	Process	Smoothened signaling pathway	IEA
GO:0007224	Process	Smoothened signaling pathway	ISS
GO:0007399	Process	Nervous system development	IEA
GO:0007420	Process	Brain development	IEA
GO:0007420	Process	Brain development	ISS
GO:0008284	Process	Positive regulation of cell population proliferation	IMP	17849174
GO:0009952	Process	Anterior/posterior pattern specification	IBA
GO:0014003	Process	Oligodendrocyte development	IEA
GO:0014003	Process	Oligodendrocyte development	ISS
GO:0021537	Process	Telencephalon development	IEA
GO:0021537	Process	Telencephalon development	ISS
GO:0021781	Process	Glial cell fate commitment	IEA
GO:0021781	Process	Glial cell fate commitment	ISS
GO:0021915	Process	Neural tube development	IEA
GO:0021915	Process	Neural tube development	ISS
GO:0021953	Process	Central nervous system neuron differentiation	IEA
GO:0022010	Process	Central nervous system myelination	IEA
GO:0022010	Process	Central nervous system myelination	ISS
GO:0030154	Process	Cell differentiation	IEA
GO:0030182	Process	Neuron differentiation	IEA
GO:0030509	Process	BMP signaling pathway	IEA
GO:0030513	Process	Positive regulation of BMP signaling pathway	IEA
GO:0030513	Process	Positive regulation of BMP signaling pathway	ISS
GO:0031641	Process	Regulation of myelination	IEA
GO:0031641	Process	Regulation of myelination	ISS
GO:0042491	Process	Inner ear auditory receptor cell differentiation	IEA
GO:0043010	Process	Camera-type eye development	IEA
GO:0043010	Process	Camera-type eye development	ISS
GO:0045595	Process	Regulation of cell differentiation	IEA
GO:0045595	Process	Regulation of cell differentiation	ISS
GO:0045596	Process	Negative regulation of cell differentiation	IEA
GO:0045608	Process	Negative regulation of inner ear auditory receptor cell differentiation	IEA
GO:0045664	Process	Regulation of neuron differentiation	IEA
GO:0045665	Process	Negative regulation of neuron differentiation	IEA
GO:0045665	Process	Negative regulation of neuron differentiation	ISS
GO:0045747	Process	Positive regulation of Notch signaling pathway	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	ISS
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0046427	Process	Positive regulation of receptor signaling pathway via JAK-STAT	IEA
GO:0046427	Process	Positive regulation of receptor signaling pathway via JAK-STAT	ISS
GO:0046983	Function	Protein dimerization activity	IEA
GO:0048469	Process	Cell maturation	IEA
GO:0048469	Process	Cell maturation	ISS
GO:0048513	Process	Animal organ development	IEA
GO:0048661	Process	Positive regulation of smooth muscle cell proliferation	IGI	19855400
GO:0048708	Process	Astrocyte differentiation	IEA
GO:0048708	Process	Astrocyte differentiation	ISS
GO:0048709	Process	Oligodendrocyte differentiation	IEA
GO:0048712	Process	Negative regulation of astrocyte differentiation	IEA
GO:0048712	Process	Negative regulation of astrocyte differentiation	ISS
GO:0048715	Process	Negative regulation of oligodendrocyte differentiation	IEA
GO:0048715	Process	Negative regulation of oligodendrocyte differentiation	ISS
GO:0048731	Process	System development	IEA
GO:0050678	Process	Regulation of epithelial cell proliferation	IEA
GO:0050767	Process	Regulation of neurogenesis	IBA
GO:0050767	Process	Regulation of neurogenesis	IEA
GO:0050767	Process	Regulation of neurogenesis	ISS
GO:0051216	Process	Cartilage development	IDA	17093926
GO:0051216	Process	Cartilage development	IEA
GO:0060122	Process	Inner ear receptor cell stereocilium organization	IEA
GO:0065003	Process	Protein-containing complex assembly	IEA
GO:0065003	Process	Protein-containing complex assembly	ISS
GO:0072049	Process	Comma-shaped body morphogenesis	IEA
GO:0072050	Process	S-shaped body morphogenesis	IEA
GO:0072086	Process	Specification of loop of Henle identity	IEA
GO:0072282	Process	Metanephric nephron tubule morphogenesis	IEA
GO:0090162	Process	Establishment of epithelial cell polarity	IEA
GO:0097150	Process	Neuronal stem cell population maintenance	IEA
GO:0097150	Process	Neuronal stem cell population maintenance	IEP	19682396
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:2000737	Process	Negative regulation of stem cell differentiation	IMP	19682396
GO:2000974	Process	Negative regulation of pro-B cell differentiation	ISS
GO:2000981	Process	Negative regulation of inner ear receptor cell differentiation	IEA

MIM	HGNC	e!Ensembl
607348	19764	ENSG00000197921

Q5TA89

Protein name

Transcription factor HES-5 (Class B basic helix-loop-helix protein 38) (bHLHb38) (Hairy and enhancer of split 5)

Protein function

Transcriptional repressor of genes that require a bHLH protein for their transcription. Plays an important role as neurogenesis negative regulator (By similarity).

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00010	HLH	17 → 73	Helix-loop-helix DNA-binding domain	Domain
PF07527	Hairy_orange	87 → 122	Hairy Orange	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in fetal heart and brain tumors. {ECO:0000269|PubMed:15254753}.

Sequence

MAPSTVAVELLSPKEKNRLRKPVVEKMRRDRINSSIEQLKLLLEQEFARHQPNSKLEKAD
ILEMAVSYLKHSKAFVAAAGPKSLHQDYSEGYSWCLQEAVQFLTLHAASDTQMKLLYHFQ
RPPAAPAAPAKEPKAPGAAPPPALSAKATAAAAAAHQPACGLWRPW

Sequence length

166

Interactions

View interactions

	KEGG		Reactome
	Notch signaling pathway Human papillomavirus infection Pathways in cancer Breast cancer		NOTCH1 Intracellular Domain Regulates Transcription Constitutive Signaling by NOTCH1 PEST Domain Mutants Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants

HES5 (hes family bHLH transcription factor 5)