Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	388551
Gene name Gene Name - the full gene name approved by the HGNC.	CEA cell adhesion molecule 16, tectorial membrane component
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CEACAM16
Synonyms (NCBI Gene) Gene synonyms aliases	CEAL2, DFNA4B, DFNB113
Disease Acronyms (UniProt) Disease acronyms from UniProt database	DFNA4B, DFNB113
Chromosome Chromosome number	19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	19q13.31-q13.32
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a secreted glycoprotein that in mouse interacts with tectorial membrane proteins in the inner ear. The encoded adhesion protein is found in cochlear outer hair cells and appears to be important for proper hearing over a

Show/Hide all(23)

miRTarBase ID	miRNA	Experiments
MIRT882920	hsa-miR-1827	CLIP-seq
MIRT882921	hsa-miR-326	CLIP-seq
MIRT882922	hsa-miR-330-5p	CLIP-seq
MIRT882923	hsa-miR-3612	CLIP-seq
MIRT882924	hsa-miR-378	CLIP-seq
MIRT882925	hsa-miR-378b	CLIP-seq
MIRT882926	hsa-miR-378c	CLIP-seq
MIRT882927	hsa-miR-378d	CLIP-seq
MIRT882928	hsa-miR-378e	CLIP-seq
MIRT882929	hsa-miR-378f	CLIP-seq
MIRT882930	hsa-miR-378h	CLIP-seq
MIRT882931	hsa-miR-378i	CLIP-seq
MIRT882932	hsa-miR-3925-3p	CLIP-seq
MIRT882933	hsa-miR-422a	CLIP-seq
MIRT882934	hsa-miR-4443	CLIP-seq
MIRT882935	hsa-miR-4638-3p	CLIP-seq
MIRT882936	hsa-miR-4685-5p	CLIP-seq
MIRT882937	hsa-miR-4722-5p	CLIP-seq
MIRT882938	hsa-miR-4768-3p	CLIP-seq
MIRT882939	hsa-miR-4773	CLIP-seq
MIRT882940	hsa-miR-650	CLIP-seq
MIRT882941	hsa-miR-766	CLIP-seq
MIRT882942	hsa-miR-940	CLIP-seq

Show/Hide all(8)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0005615	Component	Extracellular space	IDA	25589040
GO:0007605	Process	Sensory perception of sound	IBA	21873635
GO:0007605	Process	Sensory perception of sound	IMP	21368133, 25589040
GO:0007605	Process	Sensory perception of sound	ISS
GO:0032426	Component	Stereocilium tip	IBA	21873635
GO:0032426	Component	Stereocilium tip	ISS
GO:0042802	Function	Identical protein binding	IDA	25589040

MIM	HGNC	e!Ensembl
614591	31948	ENSG00000213892

Protein

UniProt ID

Q2WEN9

Protein name

Cell adhesion molecule CEACAM16 (Carcinoembryonic antigen-like 2) (Carcinoembryonic antigen-related cell adhesion molecule 16) (CEA cell adhesion molecule 16)

Protein function

Required for proper hearing, plays a role in maintaining the integrity of the tectorial membrane.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13895	Ig_2	132 → 219	Immunoglobulin domain	Domain
PF13895	Ig_2	228 → 312	Immunoglobulin domain	Domain
PF07686	V-set	321 → 422	Immunoglobulin V-set domain	Domain

Sequence

MALTGYSWLLLSATFLNVGAEISITLEPAQPSEGDNVTLVVHGLSGELLAYSWYAGPTLS
VSYLVASYIVSTGDETPGPAHTGREAVRPDGSLDIQGILPRHSGTYILQTFNRQLQTEVG
YGHVQVHEILAQPTVLANSTALVERRDTLRLMCSSPSPTAEVRWFFNGGALPVALRLGLS
PDGRVLARHGIRREEAGAYQCEVWNPVSVSRSEPINLTVYFGPERVAILQDSTTRTGCTI
KVDFNTSLTLWCVSRSCPEPEYVWTFNGQALKNGQDHLNISSMTAAQEGTYTCIAKNTKT
LLSGSASVVVKLSAAAVATMIVPVPTKPTEGQDVTLTVQGYPKDLLVYAWYRGPASEPNR
LLSQLPSGTWIAGPAHTGREVGFPNCSLLVQKLNLTDTGRYTLKTVTVQGKTETLEVELQ
VAPLG

Sequence length

425

Interactions

View interactions

Show/Hide Causal Diseases (3)

Disease term	Disease name	dbSNP ID	References
Causal
Deafness	DEAFNESS, AUTOSOMAL DOMINANT 4B	rs267607135, rs387906219, rs387906220, rs387906221, rs387906222, rs606231120, rs267606855, rs121918370, rs137853185, rs137853186, rs137853187, rs137853188, rs587776522, rs587776523, rs200781822 View all (1019 more)	26648831, 21368133, 25589040
Hearing loss	Sensorineural Hearing Loss (disorder)	rs267607135, rs267606855, rs779841884, rs267606854, rs28942097, rs121908073, rs121908076, rs74315289, rs121908144, rs111033313, rs74315437, rs121908348, rs121908349, rs121908350, rs397515359 View all (184 more)
Nonsyndromic deafness	Nonsyndromic Deafness	rs606231410, rs794729665, rs730880338, rs1566538321	25589040, 21368133, 26648831, 22544735

Show/Hide Unknown Diseases (3)

Disease term	Disease name	Source
Unknown
Eczema	Eczema	GWAS
Multiple Sclerosis	Multiple Sclerosis	GWAS
Alzheimer disease	Alzheimer disease	GWAS

Show/Hide Text Mining Associations (3)

Disease Name	Relationship Type	References
Associations from Text Mining
Deafness	Associate	29703829
Hearing Loss	Associate	29703829
Nonsyndromic Deafness	Associate	29703829

CEACAM16 (CEA cell adhesion molecule 16, tectorial membrane component)