C2CD4B (C2 calcium dependent domain containing 4B)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
388125
Gene name Gene Name - the full gene name approved by the HGNC.
C2 calcium dependent domain containing 4B
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
C2CD4B
Synonyms (NCBI Gene) Gene synonyms aliases
FAM148B, NLF2
Chromosome Chromosome number
15
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
15q22.2
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(23)
miRTarBase ID miRNA Experiments Reference
MIRT495026 hsa-miR-1273d PAR-CLIP 23708386
MIRT495025 hsa-miR-660-5p PAR-CLIP 23708386
MIRT495024 hsa-miR-5588-3p PAR-CLIP 23708386
MIRT495022 hsa-miR-6814-5p PAR-CLIP 23708386
MIRT495023 hsa-miR-150-5p PAR-CLIP 23708386
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(4)
GO ID Ontology Definition Evidence Reference
GO:0002528 Process Regulation of vascular permeability involved in acute inflammatory response IDA 15527968
GO:0002675 Process Positive regulation of acute inflammatory response IDA 15527968
GO:0005634 Component Nucleus NAS 15527968
GO:0030155 Process Regulation of cell adhesion IDA 15527968
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
610344 33628 ENSG00000205502
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID A6NLJ0
Protein name C2 calcium-dependent domain-containing protein 4B (Nuclear-localized factor 2) (Protein FAM148B)
Protein function May be involved in inflammatory process. May regulate cell architecture and adhesion.
Family and domains
Tissue specificity TISSUE SPECIFICITY: Specifically expressed in endothelial cells. {ECO:0000269|PubMed:15527968}.
Sequence 
MRLLEKLCSSAAGSSAPKPAFAKVLTPNRIPEFCIPPRLPAPCTLESPIRAAAVPRRCAA
ESDLWPRAADEDAGRTDWDPRSQAALSLPHLPRVRTTYGFCALLESPHTRRKESLLLGGP
PAPRPRAHSCGGGGGPDAPLGTLCGPRGPGPATPAAPGGPRLPQDALAAGPRRCRLLRVP
DGLLSRALRAGRSRRLARVRSVSSGNEDEERRAGSESPARAPSSSPLSSRAPLPERLEAK
GTVALGRAGDALRLAAEYCPGTRRLRLRLLRAESLFGGAPGPRAVRCRLSLVLRPPGTAR
WQCSAVVGRSRKASFDQDFCFDGLSEDEVRRLAVRVKARDEGRGRDRGRLLGQGELSLGA
LLLL
Sequence length 364
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Diabetes mellitus Diabetes Mellitus, Non-Insulin-Dependent rs587776515, rs61730328, rs606231121, rs606231122, rs79020217, rs77625743, rs78378398, rs606231123, rs1362648752, rs104893649, rs80356624, rs80356616, rs80356625, rs80356611, rs104894237
View all (293 more)		 20818381
Show/Hide Unknown Diseases (1)
Unknown
Disease term Disease name Evidence References Source
Diabetes Diabetes GWAS
Show/Hide Text Mining Associations (2)
Associations from Text Mining
Disease Name Relationship Type References
Lupus Erythematosus Systemic Associate 23740754
Uveitis Associate 36834715