Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
388125
Gene name Gene Name - the full gene name approved by the HGNC.
C2 calcium dependent domain containing 4B
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
C2CD4B
Synonyms (NCBI Gene) Gene synonyms aliases
FAM148B, NLF2
Chromosome Chromosome number
15
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
15q22.2
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT495026 hsa-miR-1273d PAR-CLIP 23708386
MIRT495025 hsa-miR-660-5p PAR-CLIP 23708386
MIRT495024 hsa-miR-5588-3p PAR-CLIP 23708386
MIRT495022 hsa-miR-6814-5p PAR-CLIP 23708386
MIRT495023 hsa-miR-150-5p PAR-CLIP 23708386
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0002528 Process Regulation of vascular permeability involved in acute inflammatory response IDA 15527968
GO:0002675 Process Positive regulation of acute inflammatory response IDA 15527968
GO:0005634 Component Nucleus IEA
GO:0005634 Component Nucleus NAS 15527968
GO:0030155 Process Regulation of cell adhesion IDA 15527968
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
610344 33628 ENSG00000205502
Protein
UniProt ID A6NLJ0
Protein name C2 calcium-dependent domain-containing protein 4B (Nuclear-localized factor 2) (Protein FAM148B)
Protein function May be involved in inflammatory process. May regulate cell architecture and adhesion.
Family and domains
Tissue specificity TISSUE SPECIFICITY: Specifically expressed in endothelial cells. {ECO:0000269|PubMed:15527968}.
Sequence
MRLLEKLCSSAAGSSAPKPAFAKVLTPNRIPEFCIPPRLPAPCTLESPIRAAAVPRRCAA
ESDLWPRAADEDAGRTDWDPRSQAALSLPHLPRVRTTYGFCALLESPHTRRKESLLLGGP
PAPRPRAHSCGGGGGPDAPLGTLCGPRGPGPATPAAPGGPRLPQDALAAGPRRCRLLRVP
DGLLSRALRAGRSRRLARVRSVSSGNEDEERRAGSESPARAPSSSPLSSRAPLPERLEAK
GTVALGRAGDALRLAAEYCPGTRRLRLRLLRAESLFGGAPGPRAVRCRLSLVLRPPGTAR
WQCSAVVGRSRKASFDQDFCFDGLSEDEVRRLAVRVKARDEGRGRDRGRLLGQGELSLGA
LLLL
Sequence length 364
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Diabetes Type 2 diabetes, Type 2 diabetes (PheCode 250.2) N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Lupus Erythematosus Systemic Associate 23740754
Uveitis Associate 36834715