Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
388021
Gene name Gene Name - the full gene name approved by the HGNC.
Transmembrane protein 179
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TMEM179
Synonyms (NCBI Gene) Gene synonyms aliases
C14orf90, TMEM179A
Chromosome Chromosome number
14
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
14q32.33
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT494888 hsa-miR-7109-3p PAR-CLIP 23708386
MIRT494887 hsa-miR-4655-5p PAR-CLIP 23708386
MIRT494886 hsa-miR-6784-5p PAR-CLIP 23708386
MIRT494885 hsa-miR-6762-5p PAR-CLIP 23708386
MIRT494884 hsa-miR-6845-5p PAR-CLIP 23708386
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0016020 Component Membrane IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
621219 20137 ENSG00000258986
Protein
UniProt ID Q6ZVK1
Protein name Transmembrane protein 179 (Transmembrane protein 179A)
Family and domains
Sequence
MALNNFLFAQCACYFLAFLFSFVVVVPLSENGHDFRGRCLLFTEGMWLSANLTVQERERF
TVQEWGPPAACRFSLLASLLSLLLAAAHAWRTLFFLCKGHEGSFFSAFLNLLVSAFVVFL
VFIASTIVSVGFTMWCDTITEKGTVPHSCEELQDIDLELGVDNSAFYDQFAIAQFGLWAS
WLAWLAITTLAFLKVYHNYRQEDLLDSLIHEKELLLARPSPRTSFQEEKSAVI
Sequence length 233
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Bipolar Disorder Bipolar disorder, Bipolar I disorder N/A N/A GWAS
Oligodendroglioma Oligodendroglioma N/A N/A GWAS
Psoriasis Psoriasis N/A N/A GWAS
Rheumatoid arthritis Rheumatoid arthritis N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Carcinoma Non Small Cell Lung Associate 34714841