TMEM179 (transmembrane protein 179)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein
Entrez ID 388021
Gene name Transmembrane protein 179
Gene symbol TMEM179
Synonyms (NCBI Gene)
C14orf90TMEM179A
Chromosome 14
Chromosome location 14q32.33
miRNA miRNA information provided by mirtarbase database.
40
Gene miRNA Gene ontology Other IDs Protein
Show/Hide all (40)
miRTarBase ID miRNA Experiments Reference
MIRT494888 hsa-miR-7109-3p PAR-CLIP 23708386
MIRT494887 hsa-miR-4655-5p PAR-CLIP 23708386
MIRT494886 hsa-miR-6784-5p PAR-CLIP 23708386
MIRT494885 hsa-miR-6762-5p PAR-CLIP 23708386
MIRT494884 hsa-miR-6845-5p PAR-CLIP 23708386
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
1
Gene miRNA Gene ontology Other IDs Protein
Show/Hide all (1)
GO ID Ontology Definition Evidence Reference
GO:0016020 Component Membrane IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein
MIM HGNC e!Ensembl
621219 20137 ENSG00000258986
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q6ZVK1
Protein name Transmembrane protein 179 (Transmembrane protein 179A)
Family and domains
Sequence 
MALNNFLFAQCACYFLAFLFSFVVVVPLSENGHDFRGRCLLFTEGMWLSANLTVQERERF
TVQEWGPPAACRFSLLASLLSLLLAAAHAWRTLFFLCKGHEGSFFSAFLNLLVSAFVVFL
VFIASTIVSVGFTMWCDTITEKGTVPHSCEELQDIDLELGVDNSAFYDQFAIAQFGLWAS
WLAWLAITTLAFLKVYHNYRQEDLLDSLIHEKELLLARPSPRTSFQEEKSAVI
Sequence length 233
Interactions View interactions