Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
387787
Gene name Gene Name - the full gene name approved by the HGNC.
Lipoyl(octanoyl) transferase 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
LIPT2
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
11q13.4
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a mitochondrial protein that catalyzes the transfer of octanoic acid to lipoate-dependent enzymes such as octanoyl-ACP. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2016]
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT1110667 hsa-let-7a CLIP-seq
MIRT1110668 hsa-let-7b CLIP-seq
MIRT1110669 hsa-let-7c CLIP-seq
MIRT1110670 hsa-let-7d CLIP-seq
MIRT1110671 hsa-let-7e CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005739 Component Mitochondrion IBA 21873635
GO:0005739 Component Mitochondrion IDA 28757203
GO:0005759 Component Mitochondrial matrix TAS
GO:0009249 Process Protein lipoylation IBA 21873635
GO:0009249 Process Protein lipoylation IMP 28757203
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
617659 37216 ENSG00000175536
Protein
UniProt ID A6NK58
Protein name Octanoyl-[acyl-carrier-protein]:protein N-octanoyltransferase LIPT2, mitochondrial (Lipoate-protein ligase B) (Lipoyl/octanoyl transferase) (Lipoyltransferase 2) (EC 2.3.1.181) (Octanoyl-[acyl-carrier-protein]-protein N-octanoyltransferase)
Protein function Catalyzes the transfer of endogenously produced octanoic acid from octanoyl-acyl-carrier-protein (octanoyl-ACP) onto the lipoyl domains of lipoate-dependent enzymes such as the protein H of the glycine cleavage system (GCSH) (PubMed:28757203). L
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF03099 BPL_LplA_LipB 69 175 Biotin/lipoate A/B protein ligase family Domain
Sequence
MRQPAVRLVRLGRVPYAELLGLQDRWLRRLQAEPGIEAPSGTEAGALLLCEPAGPVYTAG
LRGGLTPEETARLRALGAEVRVTGRGGLATFHGPGQLLCHPVLDLRRLGLRLRMHVASLE
ACAVRLCELQGLQDARARPPPYTGVWLDDRKICAIGVRCGRHITSHGLALNCSTD
LTWFE
HIVPCGLVGTGVTSLSKELQRHVTVEEVMPPFLVAFKEIYKCTLISEDSPN
Sequence length 231
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Lipoic acid metabolism
Metabolic pathways
Biosynthesis of cofactors
  Glyoxylate metabolism and glycine degradation
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Developmental delay Profound global developmental delay rs28941770, rs199469464, rs281865469, rs143747297, rs398123009, rs587777428, rs786205133, rs606231459, rs797044854, rs797045027, rs864309504, rs878853160, rs886039902, rs886042046, rs886041291
View all (32 more)
Encephalopathy ENCEPHALOPATHY, NEONATAL SEVERE, WITH LACTIC ACIDOSIS AND BRAIN ABNORMALITIES rs118204095, rs118204096, rs118204101, rs118204109, rs118204119, rs28939378, rs121908531, rs28936674, rs80359829, rs80359828, rs80359816, rs80359814, rs2124448824, rs121909739, rs121909740
View all (107 more)
30914295, 28803783, 28757203
Epileptic encephalopathy Encephalopathies rs587776508, rs121918334, rs121918317, rs121918321, rs74315390, rs28939684, rs74315391, rs74315392, rs118192244, rs121918622, rs121918623, rs121917953, rs121917955, rs121918624, rs121918625
View all (860 more)
Lipoyltransferase deficiency Lipoyl transferase 2 deficiency rs786205156, rs767568897, rs863224892, rs137891647, rs1468529365
Unknown
Disease term Disease name Evidence References Source
Spastic tetraparesis Spastic tetraparesis ClinVar
Associations from Text Mining
Disease Name Relationship Type References
Brain Diseases Stimulate 38129565
Breast Neoplasms Associate 36213577
Carcinoma Renal Cell Associate 38129565
DNA Virus Infections Associate 38129565
Esophageal Neoplasms Associate 38159255
Glioblastoma Stimulate 38129565
Glioma Stimulate 38129565
Glioma Associate 40355831
Inflammatory Bowel Diseases Associate 33588072
Kidney Diseases Stimulate 38129565