Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	387357
Gene name Gene Name - the full gene name approved by the HGNC.	Thymocyte selection associated
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	THEMIS
Synonyms (NCBI Gene) Gene synonyms aliases	C6orf190, C6orf207, GASP, SPOT, THEMIS1, TSEPA
Chromosome Chromosome number	6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	6q22.33
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a protein that plays a regulatory role in both positive and negative T-cell selection during late thymocyte development. The protein functions through T-cell antigen receptor signaling, and is necessary for proper lineage commitment and

Show/Hide all(27)

miRTarBase ID	miRNA	Experiments
MIRT1423355	hsa-miR-1258	CLIP-seq
MIRT1423356	hsa-miR-129-3p	CLIP-seq
MIRT1423357	hsa-miR-154	CLIP-seq
MIRT1423358	hsa-miR-28-3p	CLIP-seq
MIRT1423359	hsa-miR-3685	CLIP-seq
MIRT1423360	hsa-miR-374c	CLIP-seq
MIRT1423361	hsa-miR-384	CLIP-seq
MIRT1423362	hsa-miR-3922-5p	CLIP-seq
MIRT1423363	hsa-miR-4326	CLIP-seq
MIRT1423364	hsa-miR-4687-3p	CLIP-seq
MIRT1423365	hsa-miR-4775	CLIP-seq
MIRT1423366	hsa-miR-486-5p	CLIP-seq
MIRT1423367	hsa-miR-577	CLIP-seq
MIRT1423368	hsa-miR-590-3p	CLIP-seq
MIRT1423369	hsa-miR-655	CLIP-seq
MIRT1423370	hsa-miR-3074-3p	CLIP-seq
MIRT1423371	hsa-miR-3607-3p	CLIP-seq
MIRT1423372	hsa-miR-3686	CLIP-seq
MIRT1423373	hsa-miR-4464	CLIP-seq
MIRT1423374	hsa-miR-4652-3p	CLIP-seq
MIRT1423375	hsa-miR-4748	CLIP-seq
MIRT1423376	hsa-miR-487a	CLIP-seq
MIRT2126846	hsa-miR-4307	CLIP-seq
MIRT2126847	hsa-miR-4420	CLIP-seq
MIRT2126848	hsa-miR-4729	CLIP-seq
MIRT2126849	hsa-miR-4772-3p	CLIP-seq
MIRT2126850	hsa-miR-5096	CLIP-seq

Show/Hide all(19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002250	Process	Adaptive immune response	IEA
GO:0002376	Process	Immune system process	IEA
GO:0005515	Function	Protein binding	IPI	21189249, 23455924, 23460737, 25535246, 28046066, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005911	Component	Cell-cell junction	IEA
GO:0008180	Component	COP9 signalosome	IEA
GO:0008180	Component	COP9 signalosome	ISS
GO:0043368	Process	Positive T cell selection	IEA
GO:0043368	Process	Positive T cell selection	ISS
GO:0043383	Process	Negative T cell selection	IEA
GO:0043383	Process	Negative T cell selection	ISS
GO:0050852	Process	T cell receptor signaling pathway	IBA
GO:0050852	Process	T cell receptor signaling pathway	IEA
GO:0050852	Process	T cell receptor signaling pathway	ISS

MIM	HGNC	e!Ensembl
613607	21569	ENSG00000172673

Protein

UniProt ID

Q8N1K5

Protein name

Protein THEMIS (Thymocyte-expressed molecule involved in selection)

Protein function

Plays a central role in late thymocyte development by controlling both positive and negative T-cell selection. Required to sustain and/or integrate signals required for proper lineage commitment and maturation of T-cells. Regulates T-cell develo

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF12736	CABIT	17 → 265	Cell-cycle sustaining, positive selection,	Domain
PF12736	CABIT	281 → 530	Cell-cycle sustaining, positive selection,	Domain

Sequence

MALSLEEFVHSLDLRTLPRVLEIQAGIYLEGSIYEMFGNECCFSTGEVIKITGLKVKKII
AEICEQIEGCESLQPFELPMNFPGLFKIVADKTPYLTMEEITRTIHIGPSRLGHPCFYHQ
KDIKLENLIIKQGEQIMLNSVEEIDGEIMVSCAVARNHQTHSFNLPLSQEGEFYECEDER
IYTLKEIVEWKIPKNRTRTVNLTDFSNKWDSTNPFPKDFYGTLILKPVYEIQGVMKFRKD
IIRILPSLDVEVKDITDSYDANWFLQLLSTEDLFEMTSKEFPIVTEVIEAPEGNHLPQSI
LQPGKTIVIHKKYQASRILASEIRSNFPKRHFLIPTSYKGKFKRRPREFPTAYDLEIAKS
EKEPLHVVATKAFHSPHDKLSSVSVGDQFLVHQSETTEVLCEGIKKVVNVLACEKILKKS
YEAALLPLYMEGGFVEVIHDKKQYPISELCKQFRLPFNVKVSVRDLSIEEDVLAATPGLQ
LEEDITDSYLLISDFANPTECWEIPVGRLNMTVQLVSNFSRDAEPFLVRTLVEEITEEQY
YMMRRYESSASHPPPRPPKHPSVEETKLTLLTLAEERTVDLPKSPKRHHVDITKKLHPNQ
AGLDSKVLIGSQNDLVDEEKERSNRGATAIAETFKNEKHQK

Sequence length

641

Interactions

View interactions

Show/Hide Unknown Diseases (7)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Asthma	Asthma, Asthma in any disease, Asthma (childhood onset)	N/A	N/A	GWAS
Celiac disease	Celiac disease	N/A	N/A	GWAS
Colorectal Cancer	Colorectal cancer	N/A	N/A	GWAS
Crohn Disease	Crohn's disease	N/A	N/A	GWAS
Inflammatory Bowel Disease	Inflammatory bowel disease	N/A	N/A	GWAS
Multiple Sclerosis	Multiple sclerosis	N/A	N/A	GWAS
Uterine Fibroids	Uterine fibroids	N/A	N/A	GWAS

Show/Hide Text Mining Associations (4)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Celiac Disease	Associate	20190752, 23820479
Diabetes Mellitus Type 1	Associate	35986039
Disease	Associate	25052311
Multiple Sclerosis	Associate	27438997

THEMIS (thymocyte selection associated)