THEMIS (thymocyte selection associated)

Gene

• Entrez ID: 387357
• Gene name: Thymocyte selection associated
• Gene symbol: THEMIS
• Synonyms (NCBI Gene): C6orf190, C6orf207, GASP, SPOT, THEMIS1, TSEPA
• Chromosome: 6
• Chromosome location: 6q22.33
• Summary: This gene encodes a protein that plays a regulatory role in both positive and negative T-cell selection during late thymocyte development. The protein functions through T-cell antigen receptor signaling, and is necessary for proper lineage commitment and

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1423355	hsa-miR-1258	CLIP-seq
MIRT1423356	hsa-miR-129-3p	CLIP-seq
MIRT1423357	hsa-miR-154	CLIP-seq
MIRT1423358	hsa-miR-28-3p	CLIP-seq
MIRT1423359	hsa-miR-3685	CLIP-seq
MIRT1423360	hsa-miR-374c	CLIP-seq
MIRT1423361	hsa-miR-384	CLIP-seq
MIRT1423362	hsa-miR-3922-5p	CLIP-seq
MIRT1423363	hsa-miR-4326	CLIP-seq
MIRT1423364	hsa-miR-4687-3p	CLIP-seq
MIRT1423365	hsa-miR-4775	CLIP-seq
MIRT1423366	hsa-miR-486-5p	CLIP-seq
MIRT1423367	hsa-miR-577	CLIP-seq
MIRT1423368	hsa-miR-590-3p	CLIP-seq
MIRT1423369	hsa-miR-655	CLIP-seq
MIRT1423370	hsa-miR-3074-3p	CLIP-seq
MIRT1423371	hsa-miR-3607-3p	CLIP-seq
MIRT1423372	hsa-miR-3686	CLIP-seq
MIRT1423373	hsa-miR-4464	CLIP-seq
MIRT1423374	hsa-miR-4652-3p	CLIP-seq
MIRT1423375	hsa-miR-4748	CLIP-seq
MIRT1423376	hsa-miR-487a	CLIP-seq
MIRT2126846	hsa-miR-4307	CLIP-seq
MIRT2126847	hsa-miR-4420	CLIP-seq
MIRT2126848	hsa-miR-4729	CLIP-seq
MIRT2126849	hsa-miR-4772-3p	CLIP-seq
MIRT2126850	hsa-miR-5096	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002250	Process	Adaptive immune response	IEA
GO:0005515	Function	Protein binding	IPI	21189249, 23455924, 25535246, 28046066
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005634	Component	Nucleus	ISS
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005737	Component	Cytoplasm	ISS
GO:0005911	Component	Cell-cell junction	IEA
GO:0008180	Component	COP9 signalosome	ISS
GO:0043368	Process	Positive T cell selection	ISS
GO:0043383	Process	Negative T cell selection	ISS
GO:0050852	Process	T cell receptor signaling pathway	IBA	21873635
GO:0050852	Process	T cell receptor signaling pathway	ISS

Other IDs

• MIM: 613607
• HGNC: 21569
• e!Ensembl: ENSG00000172673

Protein

• UniProt ID: Q8N1K5
• Protein name: Protein THEMIS (Thymocyte-expressed molecule involved in selection)
• Protein function: Plays a central role in late thymocyte development by controlling both positive and negative T-cell selection. Required to sustain and/or integrate signals required for proper lineage commitment and maturation of T-cells. Regulates T-cell develo
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF12736	CABIT	17 → 265	Cell-cycle sustaining, positive selection,	Domain
  PF12736	CABIT	281 → 530	Cell-cycle sustaining, positive selection,	Domain

• Sequence:

  MALSLEEFVHSLDLRTLPRVLEIQAGIYLEGSIYEMFGNECCFSTGEVIKITGLKVKKII
  AEICEQIEGCESLQPFELPMNFPGLFKIVADKTPYLTMEEITRTIHIGPSRLGHPCFYHQ
  KDIKLENLIIKQGEQIMLNSVEEIDGEIMVSCAVARNHQTHSFNLPLSQEGEFYECEDER
  IYTLKEIVEWKIPKNRTRTVNLTDFSNKWDSTNPFPKDFYGTLILKPVYEIQGVMKFRKD
  IIRILPSLDVEVKDITDSYDANWFLQLLSTEDLFEMTSKEFPIVTEVIEAPEGNHLPQSI
  LQPGKTIVIHKKYQASRILASEIRSNFPKRHFLIPTSYKGKFKRRPREFPTAYDLEIAKS
  EKEPLHVVATKAFHSPHDKLSSVSVGDQFLVHQSETTEVLCEGIKKVVNVLACEKILKKS
  YEAALLPLYMEGGFVEVIHDKKQYPISELCKQFRLPFNVKVSVRDLSIEEDVLAATPGLQ
  LEEDITDSYLLISDFANPTECWEIPVGRLNMTVQLVSNFSRDAEPFLVRTLVEEITEEQY
  YMMRRYESSASHPPPRPPKHPSVEETKLTLLTLAEERTVDLPKSPKRHHVDITKKLHPNQ
  AGLDSKVLIGSQNDLVDEEKERSNRGATAIAETFKNEKHQK

• Sequence length: 641

Associated diseases

Unknown
Disease term	Disease name	Evidence	References	Source
Celiac disease	Celiac Disease, Celiac disease		20190752, 25920553	ClinVar, GWAS
Multiple Sclerosis	Multiple Sclerosis			GWAS
Asthma	Asthma			GWAS
Uterine Fibroids	Uterine Fibroids			GWAS
Crohn Disease	Crohn Disease			GWAS
Inflammatory Bowel Disease	Inflammatory Bowel Disease			GWAS
Colorectal Cancer	Colorectal Cancer	In summary, our data strongly demonstrated that upregulation of GRB7 conferred MEKi resistance in CRC cells with KRAS mutations by mediating RTK signaling through the recruitment of PLK1.		GWAS, CBGDA

Associations from Text Mining
Disease Name	Relationship Type	References
Celiac Disease	Associate	20190752, 23820479
Diabetes Mellitus Type 1	Associate	35986039
Disease	Associate	25052311
Multiple Sclerosis	Associate	27438997