NPSR1 (neuropeptide S receptor 1)

Gene

• Entrez ID: 387129
• Gene name: Neuropeptide S receptor 1
• Gene symbol: NPSR1
• Synonyms (NCBI Gene): ASRT2, GPR154, GPRA, NPSR, PGR14, VRR1
• Chromosome: 7
• Chromosome location: 7p14.3
• Summary: This gene encodes a member of the vasopressin/oxytocin subfamily of G protein-coupled receptors. The encoded membrane protein acts as a receptor for neuropeptide S and affects a variety of cellular processes through its signaling. Increased expression of

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1191311	hsa-miR-1343	CLIP-seq
MIRT1191312	hsa-miR-2110	CLIP-seq
MIRT1191313	hsa-miR-3064-5p	CLIP-seq
MIRT1191314	hsa-miR-3173-3p	CLIP-seq
MIRT1191315	hsa-miR-3652	CLIP-seq
MIRT1191316	hsa-miR-3667-3p	CLIP-seq
MIRT1191317	hsa-miR-4271	CLIP-seq
MIRT1191318	hsa-miR-4430	CLIP-seq
MIRT1191319	hsa-miR-4446-3p	CLIP-seq
MIRT1191320	hsa-miR-4476	CLIP-seq
MIRT1191321	hsa-miR-4492	CLIP-seq
MIRT1191322	hsa-miR-4498	CLIP-seq
MIRT1191323	hsa-miR-4505	CLIP-seq
MIRT1191324	hsa-miR-4533	CLIP-seq
MIRT1191325	hsa-miR-4646-5p	CLIP-seq
MIRT1191326	hsa-miR-4721	CLIP-seq
MIRT1191327	hsa-miR-4725-3p	CLIP-seq
MIRT1191328	hsa-miR-4779	CLIP-seq
MIRT1191329	hsa-miR-4790-3p	CLIP-seq
MIRT1191330	hsa-miR-491-5p	CLIP-seq
MIRT1191331	hsa-miR-541	CLIP-seq
MIRT1191332	hsa-miR-654-5p	CLIP-seq
MIRT1191333	hsa-miR-762	CLIP-seq
MIRT1191334	hsa-miR-1253	CLIP-seq
MIRT1191335	hsa-miR-3918	CLIP-seq
MIRT1191336	hsa-miR-4269	CLIP-seq
MIRT1191337	hsa-miR-4645-5p	CLIP-seq
MIRT1191338	hsa-miR-4673	CLIP-seq
MIRT1191339	hsa-miR-4733-3p	CLIP-seq
MIRT1191340	hsa-miR-4795-5p	CLIP-seq
MIRT2284398	hsa-miR-4504	CLIP-seq
MIRT1191314	hsa-miR-3173-3p	CLIP-seq
MIRT2582352	hsa-miR-4435	CLIP-seq
MIRT1191319	hsa-miR-4446-3p	CLIP-seq
MIRT1191321	hsa-miR-4492	CLIP-seq
MIRT1191322	hsa-miR-4498	CLIP-seq
MIRT1191323	hsa-miR-4505	CLIP-seq
MIRT1191324	hsa-miR-4533	CLIP-seq
MIRT1191325	hsa-miR-4646-5p	CLIP-seq
MIRT1191326	hsa-miR-4721	CLIP-seq
MIRT2582353	hsa-miR-4747-5p	CLIP-seq
MIRT1191328	hsa-miR-4779	CLIP-seq
MIRT1191333	hsa-miR-762	CLIP-seq
MIRT1191314	hsa-miR-3173-3p	CLIP-seq
MIRT2582352	hsa-miR-4435	CLIP-seq
MIRT1191319	hsa-miR-4446-3p	CLIP-seq
MIRT1191321	hsa-miR-4492	CLIP-seq
MIRT1191322	hsa-miR-4498	CLIP-seq
MIRT1191323	hsa-miR-4505	CLIP-seq
MIRT1191324	hsa-miR-4533	CLIP-seq
MIRT1191325	hsa-miR-4646-5p	CLIP-seq
MIRT1191326	hsa-miR-4721	CLIP-seq
MIRT2582353	hsa-miR-4747-5p	CLIP-seq
MIRT1191328	hsa-miR-4779	CLIP-seq
MIRT1191333	hsa-miR-762	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
RORA	Repression	23565190

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0005000	Function	Vasopressin receptor activity	IEA
GO:0005737	Component	Cytoplasm	IDA	15947423
GO:0005737	Component	Cytoplasm	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	15947423, 16790440
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007218	Process	Neuropeptide signaling pathway	IDA	15947423
GO:0007218	Process	Neuropeptide signaling pathway	IEA
GO:0008188	Function	Neuropeptide receptor activity	IBA
GO:0008188	Function	Neuropeptide receptor activity	IDA	16790440
GO:0008188	Function	Neuropeptide receptor activity	IEA
GO:0016020	Component	Membrane	IEA
GO:0042755	Process	Eating behavior	IEA
GO:0051281	Process	Positive regulation of release of sequestered calcium ion into cytosol	IBA
GO:0051281	Process	Positive regulation of release of sequestered calcium ion into cytosol	IDA	16790440
GO:0060013	Process	Righting reflex	IEA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IEA
GO:1903999	Process	Negative regulation of eating behavior	IEA
GO:2000293	Process	Negative regulation of defecation	IEA

Other IDs

• MIM: 608595
• HGNC: 23631
• e!Ensembl: ENSG00000187258

Protein

• UniProt ID: Q6W5P4
• Protein name: Neuropeptide S receptor (G-protein coupled receptor 154) (G-protein coupled receptor PGR14) (G-protein coupled receptor for asthma susceptibility)
• Protein function: G-protein coupled receptor for neuropeptide S (NPS) (PubMed:16790440). Promotes mobilization of intracellular Ca(2+) stores (PubMed:16790440). Inhibits cell growth in response to NPS binding (PubMed:15947423). Involved in pathogenesis of asthma
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	66 → 330	7 transmembrane receptor (rhodopsin family)	Family

• Tissue specificity: TISSUE SPECIFICITY: Isoform 4 is ubiquitous; it is detected in glandular epithelia of bronchus, stomach, small intestine, colon, uterus, esophagus, spleen, kidney, pancreas, prostate and breast. Isoform 1 is detected in uterus, colon and prostate, and in
• Sequence:

  MPANFTEGSFDSSGTGQTLDSSPVACTETVTFTEVVEGKEWGSFYYSFKTEQLITLWVLF
  VFTIVGNSVVLFSTWRRKKKSRMTFFVTQLAITDSFTGLVNILTDINWRFTGDFTAPDLV
  CRVVRYLQVVLLYASTYVLVSLSIDRYHAIVYPMKFLQGEKQARVLIVIAWSLSFLFSIP
  TLIIFGKRTLSNGEVQCWALWPDDSYWTPYMTIVAFLVYFIPLTIISIMYGIVIRTIWIK
  SKTYETVISNCSDGKLCSSYNRGLISKAKIKAIKYSIIIILAFICCWSPYFLFDILDNFN
  LLPDTQERFYASVIIQNLPALNSAINPLIYCVFSSSISFPCREQRSQDSRMTFRERTERH
  EMQILSKPEFI

• Sequence length: 371

Pathways

KEGG:

Neuroactive ligand-receptor interaction

Reactome:

Peptide ligand-binding receptors
G alpha (q) signalling events
G alpha (s) signalling events
ADORA2B mediated anti-inflammatory cytokines production

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ASTHMA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma-related traits, susceptibility to, 2	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Adenocarcinoma of Lung	Associate	34550610	★☆☆☆☆ Found in Text Mining only
Agoraphobia	Associate	31734525	★☆☆☆☆ Found in Text Mining only
Anxiety	Associate	19732772, 20179762, 21525857, 22216302, 24331455, 24800784, 25971599, 27176146, 27990720, 31734525, 32321595	★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Associate	21525857, 24331455, 25971599	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Associate	20179762, 22216302	★☆☆☆☆ Found in Text Mining only
Asthma	Associate	16790440, 17702965, 18305139, 19247692, 19325992, 19732772, 19951440, 20179762, 21707994, 22216302, 23372674, 23663310, 24253534, 24386135, 28463995, 30532529	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic Disease	Associate	20179762	★☆☆☆☆ Found in Text Mining only
Conversion Disorder	Associate	24253534	★☆☆☆☆ Found in Text Mining only
Death	Associate	27990720	★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Associate	24331455	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis Atopic 1	Associate	18305139	★☆☆☆☆ Found in Text Mining only
Disease	Associate	27990720	★☆☆☆☆ Found in Text Mining only
Disruptive Impulse Control and Conduct Disorders	Associate	24331455	★☆☆☆☆ Found in Text Mining only
Drug Hypersensitivity	Associate	18305139, 21707994, 23372674, 23936416	★☆☆☆☆ Found in Text Mining only
Eczema	Associate	24260339	★☆☆☆☆ Found in Text Mining only
Emphysema	Associate	30532529	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Associate	19732772, 22216302	★☆☆☆☆ Found in Text Mining only
Heart Failure	Associate	27990720	★☆☆☆☆ Found in Text Mining only
Inflammation	Associate	20179762, 22216302	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Associate	19732772, 20179762, 22216302, 24386135	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Limbic Encephalitis	Associate	31734525	★☆☆☆☆ Found in Text Mining only
Mental Disorders	Associate	24331455, 32321595	★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	24915894, 36253428	★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Associate	24915894	★☆☆☆☆ Found in Text Mining only
Obesity	Associate	33332443	★☆☆☆☆ Found in Text Mining only
Obsessive Compulsive Disorder	Associate	23680103	★☆☆☆☆ Found in Text Mining only
Pain	Associate	19732772	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Associate	25945796	★☆☆☆☆ Found in Text Mining only
Panic Disorder	Associate	21525857, 22078257, 22216302, 23680103, 24331455, 25971599, 31734525	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Associate	31734525	★☆☆☆☆ Found in Text Mining only
Pathophobia	Associate	24331455	★☆☆☆☆ Found in Text Mining only
Psychological Distress	Associate	30242809	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Associate	24253534	★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic	Associate	23663310	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Associate	22078257, 23680103	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sleep Initiation and Maintenance Disorders	Associate	32846769	★☆☆☆☆ Found in Text Mining only
Sleep Wake Disorders	Associate	36137075	★☆☆☆☆ Found in Text Mining only
Stiff Person Syndrome	Associate	22078257	★☆☆☆☆ Found in Text Mining only
Stress Disorders Post Traumatic	Associate	31291233	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Associate	35030041	★☆☆☆☆ Found in Text Mining only
Wounds and Injuries	Associate	32321595	★☆☆☆☆ Found in Text Mining only