Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	387129
Gene name Gene Name - the full gene name approved by the HGNC.	Neuropeptide S receptor 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	NPSR1
Synonyms (NCBI Gene) Gene synonyms aliases	ASRT2, GPR154, GPRA, NPSR, PGR14, VRR1
Chromosome Chromosome number	7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	7p14.3
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the vasopressin/oxytocin subfamily of G protein-coupled receptors. The encoded membrane protein acts as a receptor for neuropeptide S and affects a variety of cellular processes through its signaling. Increased expression of

Show/Hide all(55)

miRTarBase ID	miRNA	Experiments
MIRT1191311	hsa-miR-1343	CLIP-seq
MIRT1191312	hsa-miR-2110	CLIP-seq
MIRT1191313	hsa-miR-3064-5p	CLIP-seq
MIRT1191314	hsa-miR-3173-3p	CLIP-seq
MIRT1191315	hsa-miR-3652	CLIP-seq
MIRT1191316	hsa-miR-3667-3p	CLIP-seq
MIRT1191317	hsa-miR-4271	CLIP-seq
MIRT1191318	hsa-miR-4430	CLIP-seq
MIRT1191319	hsa-miR-4446-3p	CLIP-seq
MIRT1191320	hsa-miR-4476	CLIP-seq
MIRT1191321	hsa-miR-4492	CLIP-seq
MIRT1191322	hsa-miR-4498	CLIP-seq
MIRT1191323	hsa-miR-4505	CLIP-seq
MIRT1191324	hsa-miR-4533	CLIP-seq
MIRT1191325	hsa-miR-4646-5p	CLIP-seq
MIRT1191326	hsa-miR-4721	CLIP-seq
MIRT1191327	hsa-miR-4725-3p	CLIP-seq
MIRT1191328	hsa-miR-4779	CLIP-seq
MIRT1191329	hsa-miR-4790-3p	CLIP-seq
MIRT1191330	hsa-miR-491-5p	CLIP-seq
MIRT1191331	hsa-miR-541	CLIP-seq
MIRT1191332	hsa-miR-654-5p	CLIP-seq
MIRT1191333	hsa-miR-762	CLIP-seq
MIRT1191334	hsa-miR-1253	CLIP-seq
MIRT1191335	hsa-miR-3918	CLIP-seq
MIRT1191336	hsa-miR-4269	CLIP-seq
MIRT1191337	hsa-miR-4645-5p	CLIP-seq
MIRT1191338	hsa-miR-4673	CLIP-seq
MIRT1191339	hsa-miR-4733-3p	CLIP-seq
MIRT1191340	hsa-miR-4795-5p	CLIP-seq
MIRT2284398	hsa-miR-4504	CLIP-seq
MIRT1191314	hsa-miR-3173-3p	CLIP-seq
MIRT2582352	hsa-miR-4435	CLIP-seq
MIRT1191319	hsa-miR-4446-3p	CLIP-seq
MIRT1191321	hsa-miR-4492	CLIP-seq
MIRT1191322	hsa-miR-4498	CLIP-seq
MIRT1191323	hsa-miR-4505	CLIP-seq
MIRT1191324	hsa-miR-4533	CLIP-seq
MIRT1191325	hsa-miR-4646-5p	CLIP-seq
MIRT1191326	hsa-miR-4721	CLIP-seq
MIRT2582353	hsa-miR-4747-5p	CLIP-seq
MIRT1191328	hsa-miR-4779	CLIP-seq
MIRT1191333	hsa-miR-762	CLIP-seq
MIRT1191314	hsa-miR-3173-3p	CLIP-seq
MIRT2582352	hsa-miR-4435	CLIP-seq
MIRT1191319	hsa-miR-4446-3p	CLIP-seq
MIRT1191321	hsa-miR-4492	CLIP-seq
MIRT1191322	hsa-miR-4498	CLIP-seq
MIRT1191323	hsa-miR-4505	CLIP-seq
MIRT1191324	hsa-miR-4533	CLIP-seq
MIRT1191325	hsa-miR-4646-5p	CLIP-seq
MIRT1191326	hsa-miR-4721	CLIP-seq
MIRT2582353	hsa-miR-4747-5p	CLIP-seq
MIRT1191328	hsa-miR-4779	CLIP-seq
MIRT1191333	hsa-miR-762	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
RORA	Repression	23565190

Show/Hide all(23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0005000	Function	Vasopressin receptor activity	IEA
GO:0005737	Component	Cytoplasm	IDA	15947423
GO:0005737	Component	Cytoplasm	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	15947423, 16790440
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007218	Process	Neuropeptide signaling pathway	IDA	15947423
GO:0007218	Process	Neuropeptide signaling pathway	IEA
GO:0008188	Function	Neuropeptide receptor activity	IBA
GO:0008188	Function	Neuropeptide receptor activity	IDA	16790440
GO:0008188	Function	Neuropeptide receptor activity	IEA
GO:0016020	Component	Membrane	IEA
GO:0042755	Process	Eating behavior	IEA
GO:0051281	Process	Positive regulation of release of sequestered calcium ion into cytosol	IBA
GO:0051281	Process	Positive regulation of release of sequestered calcium ion into cytosol	IDA	16790440
GO:0060013	Process	Righting reflex	IEA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IEA
GO:1903999	Process	Negative regulation of eating behavior	IEA
GO:2000293	Process	Negative regulation of defecation	IEA

MIM	HGNC	e!Ensembl
608595	23631	ENSG00000187258

Protein

UniProt ID

Q6W5P4

Protein name

Neuropeptide S receptor (G-protein coupled receptor 154) (G-protein coupled receptor PGR14) (G-protein coupled receptor for asthma susceptibility)

Protein function

G-protein coupled receptor for neuropeptide S (NPS) (PubMed:16790440). Promotes mobilization of intracellular Ca(2+) stores (PubMed:16790440). Inhibits cell growth in response to NPS binding (PubMed:15947423). Involved in pathogenesis of asthma

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	66 → 330	7 transmembrane receptor (rhodopsin family)	Family

Tissue specificity

TISSUE SPECIFICITY: Isoform 4 is ubiquitous; it is detected in glandular epithelia of bronchus, stomach, small intestine, colon, uterus, esophagus, spleen, kidney, pancreas, prostate and breast. Isoform 1 is detected in uterus, colon and prostate, and in

Sequence

MPANFTEGSFDSSGTGQTLDSSPVACTETVTFTEVVEGKEWGSFYYSFKTEQLITLWVLF
VFTIVGNSVVLFSTWRRKKKSRMTFFVTQLAITDSFTGLVNILTDINWRFTGDFTAPDLV
CRVVRYLQVVLLYASTYVLVSLSIDRYHAIVYPMKFLQGEKQARVLIVIAWSLSFLFSIP
TLIIFGKRTLSNGEVQCWALWPDDSYWTPYMTIVAFLVYFIPLTIISIMYGIVIRTIWIK
SKTYETVISNCSDGKLCSSYNRGLISKAKIKAIKYSIIIILAFICCWSPYFLFDILDNFN
LLPDTQERFYASVIIQNLPALNSAINPLIYCVFSSSISFPCREQRSQDSRMTFRERTERH
EMQILSKPEFI

Sequence length

371

Interactions

View interactions

	KEGG		Reactome
	Neuroactive ligand-receptor interaction		Peptide ligand-binding receptors G alpha (q) signalling events G alpha (s) signalling events ADORA2B mediated anti-inflammatory cytokines production

Show/Hide Unknown Diseases (2)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Asthma	Asthma-related traits, susceptibility to, 2	N/A	N/A	ClinVar
Ovarian cancer	Epithelial ovarian cancer	N/A	N/A	GWAS

Show/Hide Text Mining Associations (41)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Adenocarcinoma of Lung	Associate	34550610
Agoraphobia	Associate	31734525
Anxiety	Associate	19732772, 20179762, 21525857, 22216302, 24331455, 24800784, 25971599, 27176146, 27990720, 31734525, 32321595
Anxiety Disorders	Associate	21525857, 24331455, 25971599
Arthritis Rheumatoid	Associate	20179762, 22216302
Asthma	Associate	16790440, 17702965, 18305139, 19247692, 19325992, 19732772, 19951440, 20179762, 21707994, 22216302, 23372674, 23663310, 24253534, 24386135, 28463995, 30532529 View all (1 more)
Chronic Disease	Associate	20179762
Conversion Disorder	Associate	24253534
Death	Associate	27990720
Depressive Disorder	Associate	24331455
Dermatitis Atopic 1	Associate	18305139
Disease	Associate	27990720
Disruptive Impulse Control and Conduct Disorders	Associate	24331455
Drug Hypersensitivity	Associate	18305139, 21707994, 23372674, 23936416
Eczema	Associate	24260339
Emphysema	Associate	30532529
Gastrointestinal Diseases	Associate	19732772, 22216302
Heart Failure	Associate	27990720
Inflammation	Associate	20179762, 22216302
Inflammatory Bowel Diseases	Associate	19732772, 20179762, 22216302, 24386135
Limbic Encephalitis	Associate	31734525
Mental Disorders	Associate	24331455, 32321595
Neoplasms	Associate	24915894, 36253428
Neuroendocrine Tumors	Associate	24915894
Obesity	Associate	33332443
Obsessive Compulsive Disorder	Associate	23680103
Pain	Associate	19732772
Pancreatic Neoplasms	Associate	25945796
Panic Disorder	Associate	21525857, 22078257, 22216302, 23680103, 24331455, 25971599, 31734525
Parkinson Disease	Associate	31734525
Pathophobia	Associate	24331455
Psychological Distress	Associate	30242809
Pulmonary Disease Chronic Obstructive	Associate	24253534
Rhinitis Allergic	Associate	23663310
Schizophrenia	Associate	22078257, 23680103
Sleep Initiation and Maintenance Disorders	Associate	32846769
Sleep Wake Disorders	Associate	36137075
Stiff Person Syndrome	Associate	22078257
Stress Disorders Post Traumatic	Associate	31291233
Thyroid Neoplasms	Associate	35030041
Wounds and Injuries	Associate	32321595

NPSR1 (neuropeptide S receptor 1)