Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	387
Gene name Gene Name - the full gene name approved by the HGNC.	Ras homolog family member A
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	RHOA
Synonyms (NCBI Gene) Gene synonyms aliases	ARH12, ARHA, EDFAOB, RHO12, RHOH12
Chromosome Chromosome number	3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	3p21.31
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskel

Show/Hide all(6)

SNP ID	Visualize variation	Clinical significance	Consequence
rs1057519951	C>G,T	Likely-pathogenic	Missense variant, 5 prime UTR variant, coding sequence variant
rs1057519952	G>A	Likely-pathogenic	Intron variant, missense variant, coding sequence variant
rs1057519953	C>A,T	Likely-pathogenic	Intron variant, missense variant, coding sequence variant
rs1057519954	T>A,C,G	Likely-pathogenic	Missense variant, 5 prime UTR variant, coding sequence variant
rs1575647025	G>A	Pathogenic	Intron variant, 5 prime UTR variant, coding sequence variant, missense variant
rs1575653629	C>T	Pathogenic	Intron variant, 5 prime UTR variant, coding sequence variant, missense variant

Show/Hide all(738)

miRTarBase ID	miRNA	Experiments	Reference
MIRT001961	hsa-miR-155-5p	Luciferase reporter assay	18794355
MIRT001961	hsa-miR-155-5p	Luciferase reporter assay	18794355
MIRT001961	hsa-miR-155-5p	Luciferase reporter assay	18794355
MIRT001961	hsa-miR-155-5p	Western blot	18794355
MIRT001961	hsa-miR-155-5p	qRT-PCR	18794355
MIRT000717	hsa-miR-122-5p	Luciferase reporter assay	19617899
MIRT000717	hsa-miR-122-5p	Luciferase reporter assay	19617899
MIRT000717	hsa-miR-122-5p	Luciferase reporter assay, Review	19935707
MIRT001961	hsa-miR-155-5p	Luciferase reporter assay	18794355
MIRT001961	hsa-miR-155-5p	Luciferase reporter assay	18794355
MIRT000088	hsa-miR-31-5p	Luciferase reporter assay, qRT-PCR, Western blot	19524507
MIRT000088	hsa-miR-31-5p	Luciferase reporter assay, qRT-PCR, Western blot	19524507
MIRT000088	hsa-miR-31-5p	Luciferase reporter assay, qRT-PCR, Western blot	19524507
MIRT004036	hsa-miR-185-5p	Luciferase reporter assay, qRT-PCR, Western blot	21186079
MIRT004036	hsa-miR-185-5p	Luciferase reporter assay, qRT-PCR, Western blot	21186079
MIRT000088	hsa-miR-31-5p	qRT-PCR, Western blot	22854067
MIRT007065	hsa-miR-31-3p	qRT-PCR, Western blot	22854067
MIRT007345	hsa-miR-200c-3p	Luciferase reporter assay, qRT-PCR, Western blot	23272142
MIRT019977	hsa-miR-375	Western blot;qRT-PCR;Microarray	20584986
MIRT022883	hsa-miR-124-3p	Microarray	18668037
MIRT046885	hsa-miR-221-3p	CLASH	23622248
MIRT041611	hsa-miR-146b-5p	CLASH	23622248
MIRT036175	hsa-miR-320c	CLASH	23622248
MIRT053178	hsa-miR-133b	Immunoblot, Luciferase reporter assay, Microarray	22179829
MIRT000088	hsa-miR-31-5p	qRT-PCR, Western blot	22736314
MIRT053178	hsa-miR-133b	Luciferase reporter assay, qRT-PCR, Western blot	22179829
MIRT437799	hsa-miR-125a-3p	Immunofluorescence, Luciferase reporter assay, qRT-PCR	23525486
MIRT438245	hsa-miR-340-5p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	24980435
MIRT438245	hsa-miR-340-5p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	24980435
MIRT712848	hsa-miR-548ac	HITS-CLIP	19536157
MIRT712847	hsa-miR-548bb-3p	HITS-CLIP	19536157
MIRT712846	hsa-miR-548d-3p	HITS-CLIP	19536157
MIRT712845	hsa-miR-548h-3p	HITS-CLIP	19536157
MIRT712844	hsa-miR-548z	HITS-CLIP	19536157
MIRT712843	hsa-miR-6800-3p	HITS-CLIP	19536157
MIRT307754	hsa-miR-3613-3p	HITS-CLIP	19536157
MIRT712842	hsa-miR-483-3p	HITS-CLIP	19536157
MIRT712841	hsa-miR-3183	HITS-CLIP	19536157
MIRT712840	hsa-miR-4723-3p	HITS-CLIP	19536157
MIRT712839	hsa-miR-6769b-3p	HITS-CLIP	19536157
MIRT355605	hsa-miR-1304-3p	HITS-CLIP	19536157
MIRT712838	hsa-miR-7110-3p	HITS-CLIP	19536157
MIRT712837	hsa-miR-607	HITS-CLIP	19536157
MIRT573551	hsa-miR-3936	PAR-CLIP	20371350
MIRT573550	hsa-miR-4517	PAR-CLIP	20371350
MIRT573549	hsa-miR-5583-3p	PAR-CLIP	20371350
MIRT573548	hsa-miR-4529-5p	PAR-CLIP	20371350
MIRT573546	hsa-miR-6877-5p	PAR-CLIP	20371350
MIRT573547	hsa-miR-6762-5p	PAR-CLIP	20371350
MIRT573545	hsa-miR-6845-5p	PAR-CLIP	20371350
MIRT573544	hsa-miR-128-1-5p	PAR-CLIP	20371350
MIRT573543	hsa-miR-128-2-5p	PAR-CLIP	20371350
MIRT573542	hsa-miR-6881-5p	PAR-CLIP	20371350
MIRT573541	hsa-miR-3187-3p	PAR-CLIP	20371350
MIRT573540	hsa-miR-1227-5p	PAR-CLIP	20371350
MIRT566020	hsa-miR-6768-3p	PAR-CLIP	20371350
MIRT566019	hsa-miR-3646	PAR-CLIP	20371350
MIRT566018	hsa-miR-1252-3p	PAR-CLIP	20371350
MIRT566017	hsa-miR-4753-5p	PAR-CLIP	20371350
MIRT566016	hsa-miR-577	PAR-CLIP	20371350
MIRT566015	hsa-miR-331-5p	PAR-CLIP	20371350
MIRT566014	hsa-miR-2054	PAR-CLIP	20371350
MIRT566013	hsa-miR-6509-5p	PAR-CLIP	20371350
MIRT469298	hsa-miR-2278	PAR-CLIP	23592263
MIRT469297	hsa-miR-4519	PAR-CLIP	23592263
MIRT469296	hsa-miR-4779	PAR-CLIP	23592263
MIRT307761	hsa-miR-4446-3p	PAR-CLIP	23592263
MIRT469295	hsa-miR-6847-5p	PAR-CLIP	23592263
MIRT437799	hsa-miR-125a-3p	PAR-CLIP	23592263
MIRT469294	hsa-miR-764	PAR-CLIP	23592263
MIRT469293	hsa-miR-3934-5p	PAR-CLIP	23592263
MIRT469292	hsa-miR-4721	PAR-CLIP	23592263
MIRT469291	hsa-miR-2467-3p	PAR-CLIP	23592263
MIRT469290	hsa-miR-6499-3p	PAR-CLIP	23592263
MIRT469289	hsa-miR-504-3p	PAR-CLIP	23592263
MIRT469288	hsa-miR-4687-3p	PAR-CLIP	23592263
MIRT469287	hsa-miR-4675	PAR-CLIP	23592263
MIRT469286	hsa-miR-4741	PAR-CLIP	23592263
MIRT469285	hsa-miR-1233-5p	PAR-CLIP	23592263
MIRT469284	hsa-miR-6778-5p	PAR-CLIP	23592263
MIRT469283	hsa-miR-597-5p	PAR-CLIP	23592263
MIRT469282	hsa-miR-3678-3p	PAR-CLIP	23592263
MIRT469281	hsa-miR-592	PAR-CLIP	23592263
MIRT469280	hsa-miR-4722-5p	PAR-CLIP	23592263
MIRT439773	ebv-miR-BART7-3p	HITS-CLIP	22473208
MIRT439772	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT439773	ebv-miR-BART7-3p	HITS-CLIP	22473208
MIRT439772	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT731596	hsa-miR-200b-3p	Luciferase reporter assay	26903801
MIRT731596	hsa-miR-200b-3p	Luciferase reporter assay	26903801
MIRT004036	hsa-miR-185-5p	qRT-PCR, Western blot	27250838
MIRT000088	hsa-miR-31-5p	Immunohistochemistry, In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	27904131
MIRT000088	hsa-miR-31-5p	Immunohistochemistry, In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	27904131
MIRT001961	hsa-miR-155-5p	qRT-PCR	28146427
MIRT001961	hsa-miR-155-5p	qRT-PCR	28146427
MIRT437799	hsa-miR-125a-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	26148871
MIRT437799	hsa-miR-125a-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	26148871
MIRT469298	hsa-miR-2278	PAR-CLIP	26701625
MIRT469291	hsa-miR-2467-3p	PAR-CLIP	26701625
MIRT307761	hsa-miR-4446-3p	PAR-CLIP	26701625
MIRT469297	hsa-miR-4519	PAR-CLIP	26701625
MIRT469287	hsa-miR-4675	PAR-CLIP	26701625
MIRT469288	hsa-miR-4687-3p	PAR-CLIP	26701625
MIRT469292	hsa-miR-4721	PAR-CLIP	26701625
MIRT469280	hsa-miR-4722-5p	PAR-CLIP	26701625
MIRT469286	hsa-miR-4741	PAR-CLIP	26701625
MIRT469296	hsa-miR-4779	PAR-CLIP	26701625
MIRT469290	hsa-miR-6499-3p	PAR-CLIP	26701625
MIRT469295	hsa-miR-6847-5p	PAR-CLIP	26701625
MIRT734264	hsa-miR-27a-3p	Immunohistochemistry (IHC), qRT-PCR, Western blotting	31915154
MIRT734265	hsa-miR-21-3p	Immunohistochemistry (IHC), qRT-PCR, Western blotting	31915154
MIRT053178	hsa-miR-133b	Luciferase reporter assay, Western blotting, qRT-PCR	32547232
MIRT736359	hsa-miR-140-3p	Western blotting, qRT-PCR	33427568
MIRT712848	hsa-miR-548ac	HITS-CLIP	19536157
MIRT712847	hsa-miR-548bb-3p	HITS-CLIP	19536157
MIRT712846	hsa-miR-548d-3p	HITS-CLIP	19536157
MIRT712845	hsa-miR-548h-3p	HITS-CLIP	19536157
MIRT712844	hsa-miR-548z	HITS-CLIP	19536157
MIRT712843	hsa-miR-6800-3p	HITS-CLIP	19536157
MIRT307754	hsa-miR-3613-3p	HITS-CLIP	19536157
MIRT712842	hsa-miR-483-3p	HITS-CLIP	19536157
MIRT712841	hsa-miR-3183	HITS-CLIP	19536157
MIRT712840	hsa-miR-4723-3p	HITS-CLIP	19536157
MIRT712839	hsa-miR-6769b-3p	HITS-CLIP	19536157
MIRT355605	hsa-miR-1304-3p	HITS-CLIP	19536157
MIRT712838	hsa-miR-7110-3p	HITS-CLIP	19536157
MIRT712837	hsa-miR-607	HITS-CLIP	19536157
MIRT573551	hsa-miR-3936	PAR-CLIP	20371350
MIRT573550	hsa-miR-4517	PAR-CLIP	20371350
MIRT573549	hsa-miR-5583-3p	PAR-CLIP	20371350
MIRT573548	hsa-miR-4529-5p	PAR-CLIP	20371350
MIRT573546	hsa-miR-6877-5p	PAR-CLIP	20371350
MIRT573547	hsa-miR-6762-5p	PAR-CLIP	20371350
MIRT573545	hsa-miR-6845-5p	PAR-CLIP	20371350
MIRT573544	hsa-miR-128-1-5p	PAR-CLIP	20371350
MIRT573543	hsa-miR-128-2-5p	PAR-CLIP	20371350
MIRT573542	hsa-miR-6881-5p	PAR-CLIP	20371350
MIRT573541	hsa-miR-3187-3p	PAR-CLIP	20371350
MIRT573540	hsa-miR-1227-5p	PAR-CLIP	20371350
MIRT566020	hsa-miR-6768-3p	PAR-CLIP	20371350
MIRT566019	hsa-miR-3646	PAR-CLIP	20371350
MIRT566018	hsa-miR-1252-3p	PAR-CLIP	20371350
MIRT566017	hsa-miR-4753-5p	PAR-CLIP	20371350
MIRT566016	hsa-miR-577	PAR-CLIP	20371350
MIRT566015	hsa-miR-331-5p	PAR-CLIP	20371350
MIRT566014	hsa-miR-2054	PAR-CLIP	20371350
MIRT566013	hsa-miR-6509-5p	PAR-CLIP	20371350
MIRT469298	hsa-miR-2278	PAR-CLIP	23592263
MIRT469297	hsa-miR-4519	PAR-CLIP	23592263
MIRT469296	hsa-miR-4779	PAR-CLIP	23592263
MIRT307761	hsa-miR-4446-3p	PAR-CLIP	23592263
MIRT469295	hsa-miR-6847-5p	PAR-CLIP	23592263
MIRT437799	hsa-miR-125a-3p	PAR-CLIP	23592263
MIRT469294	hsa-miR-764	PAR-CLIP	23592263
MIRT469293	hsa-miR-3934-5p	PAR-CLIP	23592263
MIRT469292	hsa-miR-4721	PAR-CLIP	23592263
MIRT469291	hsa-miR-2467-3p	PAR-CLIP	23592263
MIRT469290	hsa-miR-6499-3p	PAR-CLIP	23592263
MIRT469289	hsa-miR-504-3p	PAR-CLIP	23592263
MIRT469288	hsa-miR-4687-3p	PAR-CLIP	23592263
MIRT469287	hsa-miR-4675	PAR-CLIP	23592263
MIRT469286	hsa-miR-4741	PAR-CLIP	23592263
MIRT469285	hsa-miR-1233-5p	PAR-CLIP	23592263
MIRT469284	hsa-miR-6778-5p	PAR-CLIP	23592263
MIRT469283	hsa-miR-597-5p	PAR-CLIP	23592263
MIRT469282	hsa-miR-3678-3p	PAR-CLIP	23592263
MIRT469281	hsa-miR-592	PAR-CLIP	23592263
MIRT469280	hsa-miR-4722-5p	PAR-CLIP	23592263
MIRT736359	hsa-miR-140-3p	Western blotting, qRT-PCR	33427568
MIRT756260	hsa-miR-1301-3p	Luciferase reporter assay	35256884
MIRT1305113	hsa-miR-103a	CLIP-seq
MIRT1305114	hsa-miR-107	CLIP-seq
MIRT1305115	hsa-miR-1207-3p	CLIP-seq
MIRT1305116	hsa-miR-1226	CLIP-seq
MIRT1305117	hsa-miR-1227	CLIP-seq
MIRT1305118	hsa-miR-1253	CLIP-seq
MIRT1305119	hsa-miR-1257	CLIP-seq
MIRT1305120	hsa-miR-1276	CLIP-seq
MIRT1305121	hsa-miR-1301	CLIP-seq
MIRT1305122	hsa-miR-144	CLIP-seq
MIRT1305123	hsa-miR-146a	CLIP-seq
MIRT1305124	hsa-miR-154	CLIP-seq
MIRT1305125	hsa-miR-185	CLIP-seq
MIRT1305126	hsa-miR-1911	CLIP-seq
MIRT1305127	hsa-miR-200b	CLIP-seq
MIRT1305128	hsa-miR-200c	CLIP-seq
MIRT1305129	hsa-miR-218	CLIP-seq
MIRT1305130	hsa-miR-300	CLIP-seq
MIRT1305131	hsa-miR-3064-3p	CLIP-seq
MIRT1305132	hsa-miR-3132	CLIP-seq
MIRT1305133	hsa-miR-3135b	CLIP-seq
MIRT1305134	hsa-miR-3150b-3p	CLIP-seq
MIRT1305135	hsa-miR-3192	CLIP-seq
MIRT1305136	hsa-miR-3200-3p	CLIP-seq
MIRT1305137	hsa-miR-323-3p	CLIP-seq
MIRT1305138	hsa-miR-326	CLIP-seq
MIRT1305139	hsa-miR-330-5p	CLIP-seq
MIRT1305140	hsa-miR-3616-5p	CLIP-seq
MIRT1305141	hsa-miR-3647-5p	CLIP-seq
MIRT1305142	hsa-miR-3650	CLIP-seq
MIRT1305143	hsa-miR-3660	CLIP-seq
MIRT1305144	hsa-miR-3689a-3p	CLIP-seq
MIRT1305145	hsa-miR-3689c	CLIP-seq
MIRT1305146	hsa-miR-381	CLIP-seq
MIRT1305147	hsa-miR-3920	CLIP-seq
MIRT1305148	hsa-miR-3934	CLIP-seq
MIRT1305149	hsa-miR-3935	CLIP-seq
MIRT1305150	hsa-miR-4259	CLIP-seq
MIRT1305151	hsa-miR-4268	CLIP-seq
MIRT1305152	hsa-miR-429	CLIP-seq
MIRT1305153	hsa-miR-4306	CLIP-seq
MIRT1305154	hsa-miR-4314	CLIP-seq
MIRT1305155	hsa-miR-4327	CLIP-seq
MIRT1305156	hsa-miR-4452	CLIP-seq
MIRT1305157	hsa-miR-4496	CLIP-seq
MIRT1305158	hsa-miR-4499	CLIP-seq
MIRT1305159	hsa-miR-451b	CLIP-seq
MIRT1305160	hsa-miR-4520a-3p	CLIP-seq
MIRT1305161	hsa-miR-4520b-3p	CLIP-seq
MIRT1305162	hsa-miR-4526	CLIP-seq
MIRT1305163	hsa-miR-4633-5p	CLIP-seq
MIRT1305164	hsa-miR-4644	CLIP-seq
MIRT1305165	hsa-miR-4645-3p	CLIP-seq
MIRT1305166	hsa-miR-4646-5p	CLIP-seq
MIRT1305167	hsa-miR-4660	CLIP-seq
MIRT1305168	hsa-miR-4666-3p	CLIP-seq
MIRT1305169	hsa-miR-4667-5p	CLIP-seq
MIRT1305170	hsa-miR-4689	CLIP-seq
MIRT1305171	hsa-miR-4698	CLIP-seq
MIRT1305172	hsa-miR-4700-5p	CLIP-seq
MIRT1305173	hsa-miR-4704-5p	CLIP-seq
MIRT1305174	hsa-miR-4715-3p	CLIP-seq
MIRT1305175	hsa-miR-4715-5p	CLIP-seq
MIRT1305176	hsa-miR-4720-3p	CLIP-seq
MIRT1305177	hsa-miR-4727-5p	CLIP-seq
MIRT1305178	hsa-miR-4728-5p	CLIP-seq
MIRT1305179	hsa-miR-4733-3p	CLIP-seq
MIRT1305180	hsa-miR-4762-3p	CLIP-seq
MIRT1305181	hsa-miR-4769-3p	CLIP-seq
MIRT1305182	hsa-miR-4784	CLIP-seq
MIRT1305183	hsa-miR-4788	CLIP-seq
MIRT1305184	hsa-miR-4789-5p	CLIP-seq
MIRT1305185	hsa-miR-4795-5p	CLIP-seq
MIRT1305186	hsa-miR-4799-5p	CLIP-seq
MIRT1305187	hsa-miR-4803	CLIP-seq
MIRT1305188	hsa-miR-4804-3p	CLIP-seq
MIRT1305189	hsa-miR-485-3p	CLIP-seq
MIRT1305190	hsa-miR-487a	CLIP-seq
MIRT1305191	hsa-miR-502-5p	CLIP-seq
MIRT1305192	hsa-miR-504	CLIP-seq
MIRT1305193	hsa-miR-5047	CLIP-seq
MIRT1305194	hsa-miR-520g	CLIP-seq
MIRT1305195	hsa-miR-520h	CLIP-seq
MIRT1305196	hsa-miR-541	CLIP-seq
MIRT1305197	hsa-miR-554	CLIP-seq
MIRT1305198	hsa-miR-561	CLIP-seq
MIRT1305199	hsa-miR-573	CLIP-seq
MIRT1305200	hsa-miR-582-3p	CLIP-seq
MIRT1305201	hsa-miR-589	CLIP-seq
MIRT1305202	hsa-miR-597	CLIP-seq
MIRT1305203	hsa-miR-617	CLIP-seq
MIRT1305204	hsa-miR-618	CLIP-seq
MIRT1305205	hsa-miR-619	CLIP-seq
MIRT1305206	hsa-miR-636	CLIP-seq
MIRT1305207	hsa-miR-637	CLIP-seq
MIRT1305127	hsa-miR-200b	CLIP-seq
MIRT1305128	hsa-miR-200c	CLIP-seq
MIRT1305147	hsa-miR-3920	CLIP-seq
MIRT1305152	hsa-miR-429	CLIP-seq
MIRT1305159	hsa-miR-451b	CLIP-seq
MIRT1305180	hsa-miR-4762-3p	CLIP-seq
MIRT1305203	hsa-miR-617	CLIP-seq
MIRT1305142	hsa-miR-3650	CLIP-seq
MIRT1305148	hsa-miR-3934	CLIP-seq
MIRT1305159	hsa-miR-451b	CLIP-seq
MIRT1305202	hsa-miR-597	CLIP-seq
MIRT2090326	hsa-miR-1185	CLIP-seq
MIRT1305115	hsa-miR-1207-3p	CLIP-seq
MIRT2090327	hsa-miR-1224-5p	CLIP-seq
MIRT1305116	hsa-miR-1226	CLIP-seq
MIRT1305118	hsa-miR-1253	CLIP-seq
MIRT1305119	hsa-miR-1257	CLIP-seq
MIRT1305120	hsa-miR-1276	CLIP-seq
MIRT2090328	hsa-miR-1286	CLIP-seq
MIRT1305121	hsa-miR-1301	CLIP-seq
MIRT2090329	hsa-miR-1304	CLIP-seq
MIRT1305122	hsa-miR-144	CLIP-seq
MIRT1305125	hsa-miR-185	CLIP-seq
MIRT1305126	hsa-miR-1911	CLIP-seq
MIRT1305127	hsa-miR-200b	CLIP-seq
MIRT1305128	hsa-miR-200c	CLIP-seq
MIRT2090330	hsa-miR-2682	CLIP-seq
MIRT2090331	hsa-miR-3129-3p	CLIP-seq
MIRT1305133	hsa-miR-3135b	CLIP-seq
MIRT1305136	hsa-miR-3200-3p	CLIP-seq
MIRT2090332	hsa-miR-323b-3p	CLIP-seq
MIRT2090333	hsa-miR-3605-5p	CLIP-seq
MIRT1305140	hsa-miR-3616-5p	CLIP-seq
MIRT1305141	hsa-miR-3647-5p	CLIP-seq
MIRT2090334	hsa-miR-3679-5p	CLIP-seq
MIRT2090335	hsa-miR-3915	CLIP-seq
MIRT1305147	hsa-miR-3920	CLIP-seq
MIRT2090336	hsa-miR-3941	CLIP-seq
MIRT1305150	hsa-miR-4259	CLIP-seq
MIRT1305152	hsa-miR-429	CLIP-seq
MIRT1305153	hsa-miR-4306	CLIP-seq
MIRT2090337	hsa-miR-4436a	CLIP-seq
MIRT1305158	hsa-miR-4499	CLIP-seq
MIRT2090338	hsa-miR-449c	CLIP-seq
MIRT1305159	hsa-miR-451b	CLIP-seq
MIRT2090339	hsa-miR-452	CLIP-seq
MIRT1305160	hsa-miR-4520a-3p	CLIP-seq
MIRT1305161	hsa-miR-4520b-3p	CLIP-seq
MIRT1305164	hsa-miR-4644	CLIP-seq
MIRT1305165	hsa-miR-4645-3p	CLIP-seq
MIRT2090340	hsa-miR-466	CLIP-seq
MIRT1305167	hsa-miR-4660	CLIP-seq
MIRT2090341	hsa-miR-4672	CLIP-seq
MIRT2090342	hsa-miR-4676-3p	CLIP-seq
MIRT1305170	hsa-miR-4689	CLIP-seq
MIRT1305171	hsa-miR-4698	CLIP-seq
MIRT1305173	hsa-miR-4704-5p	CLIP-seq
MIRT1305175	hsa-miR-4715-5p	CLIP-seq
MIRT1305179	hsa-miR-4733-3p	CLIP-seq
MIRT1305180	hsa-miR-4762-3p	CLIP-seq
MIRT1305185	hsa-miR-4795-5p	CLIP-seq
MIRT1305186	hsa-miR-4799-5p	CLIP-seq
MIRT1305189	hsa-miR-485-3p	CLIP-seq
MIRT1305190	hsa-miR-487a	CLIP-seq
MIRT1305192	hsa-miR-504	CLIP-seq
MIRT1305193	hsa-miR-5047	CLIP-seq
MIRT1305196	hsa-miR-541	CLIP-seq
MIRT2090343	hsa-miR-548a-3p	CLIP-seq
MIRT2090344	hsa-miR-548ag	CLIP-seq
MIRT2090345	hsa-miR-548ai	CLIP-seq
MIRT2090346	hsa-miR-548e	CLIP-seq
MIRT2090347	hsa-miR-548f	CLIP-seq
MIRT1305199	hsa-miR-573	CLIP-seq
MIRT1305203	hsa-miR-617	CLIP-seq
MIRT2090348	hsa-miR-940	CLIP-seq
MIRT1305113	hsa-miR-103a	CLIP-seq
MIRT1305114	hsa-miR-107	CLIP-seq
MIRT1305115	hsa-miR-1207-3p	CLIP-seq
MIRT1305116	hsa-miR-1226	CLIP-seq
MIRT2315200	hsa-miR-1244	CLIP-seq
MIRT1305118	hsa-miR-1253	CLIP-seq
MIRT1305119	hsa-miR-1257	CLIP-seq
MIRT1305121	hsa-miR-1301	CLIP-seq
MIRT2315201	hsa-miR-142-5p	CLIP-seq
MIRT1305123	hsa-miR-146a	CLIP-seq
MIRT1305124	hsa-miR-154	CLIP-seq
MIRT1305125	hsa-miR-185	CLIP-seq
MIRT1305126	hsa-miR-1911	CLIP-seq
MIRT1305127	hsa-miR-200b	CLIP-seq
MIRT1305128	hsa-miR-200c	CLIP-seq
MIRT1305129	hsa-miR-218	CLIP-seq
MIRT1305130	hsa-miR-300	CLIP-seq
MIRT2315202	hsa-miR-302f	CLIP-seq
MIRT1305132	hsa-miR-3132	CLIP-seq
MIRT1305133	hsa-miR-3135b	CLIP-seq
MIRT2315203	hsa-miR-3152-5p	CLIP-seq
MIRT1305135	hsa-miR-3192	CLIP-seq
MIRT1305136	hsa-miR-3200-3p	CLIP-seq
MIRT1305138	hsa-miR-326	CLIP-seq
MIRT1305139	hsa-miR-330-5p	CLIP-seq
MIRT2315204	hsa-miR-337-3p	CLIP-seq
MIRT2315205	hsa-miR-340	CLIP-seq
MIRT1305142	hsa-miR-3650	CLIP-seq
MIRT1305143	hsa-miR-3660	CLIP-seq
MIRT1305144	hsa-miR-3689a-3p	CLIP-seq
MIRT1305145	hsa-miR-3689c	CLIP-seq
MIRT1305146	hsa-miR-381	CLIP-seq
MIRT1305147	hsa-miR-3920	CLIP-seq
MIRT1305148	hsa-miR-3934	CLIP-seq
MIRT1305149	hsa-miR-3935	CLIP-seq
MIRT2315206	hsa-miR-3937	CLIP-seq
MIRT1305150	hsa-miR-4259	CLIP-seq
MIRT1305151	hsa-miR-4268	CLIP-seq
MIRT1305152	hsa-miR-429	CLIP-seq
MIRT1305153	hsa-miR-4306	CLIP-seq
MIRT1305154	hsa-miR-4314	CLIP-seq
MIRT1305155	hsa-miR-4327	CLIP-seq
MIRT1305156	hsa-miR-4452	CLIP-seq
MIRT1305158	hsa-miR-4499	CLIP-seq
MIRT1305159	hsa-miR-451b	CLIP-seq
MIRT1305160	hsa-miR-4520a-3p	CLIP-seq
MIRT1305161	hsa-miR-4520b-3p	CLIP-seq
MIRT1305162	hsa-miR-4526	CLIP-seq
MIRT1305163	hsa-miR-4633-5p	CLIP-seq
MIRT1305164	hsa-miR-4644	CLIP-seq
MIRT1305166	hsa-miR-4646-5p	CLIP-seq
MIRT1305167	hsa-miR-4660	CLIP-seq
MIRT1305168	hsa-miR-4666-3p	CLIP-seq
MIRT1305169	hsa-miR-4667-5p	CLIP-seq
MIRT1305171	hsa-miR-4698	CLIP-seq
MIRT2315207	hsa-miR-4699-3p	CLIP-seq
MIRT1305172	hsa-miR-4700-5p	CLIP-seq
MIRT1305173	hsa-miR-4704-5p	CLIP-seq
MIRT1305174	hsa-miR-4715-3p	CLIP-seq
MIRT1305175	hsa-miR-4715-5p	CLIP-seq
MIRT2315208	hsa-miR-4719	CLIP-seq
MIRT1305176	hsa-miR-4720-3p	CLIP-seq
MIRT1305178	hsa-miR-4728-5p	CLIP-seq
MIRT1305179	hsa-miR-4733-3p	CLIP-seq
MIRT2315209	hsa-miR-4735-5p	CLIP-seq
MIRT2315210	hsa-miR-4760-3p	CLIP-seq
MIRT1305180	hsa-miR-4762-3p	CLIP-seq
MIRT1305184	hsa-miR-4789-5p	CLIP-seq
MIRT1305186	hsa-miR-4799-5p	CLIP-seq
MIRT1305188	hsa-miR-4804-3p	CLIP-seq
MIRT1305192	hsa-miR-504	CLIP-seq
MIRT1305193	hsa-miR-5047	CLIP-seq
MIRT2315211	hsa-miR-513b	CLIP-seq
MIRT1305194	hsa-miR-520g	CLIP-seq
MIRT1305195	hsa-miR-520h	CLIP-seq
MIRT1305196	hsa-miR-541	CLIP-seq
MIRT2315212	hsa-miR-548a-5p	CLIP-seq
MIRT2315213	hsa-miR-548ab	CLIP-seq
MIRT2315214	hsa-miR-548ak	CLIP-seq
MIRT2315215	hsa-miR-548b-5p	CLIP-seq
MIRT2315216	hsa-miR-548c-5p	CLIP-seq
MIRT2315217	hsa-miR-548d-5p	CLIP-seq
MIRT2315218	hsa-miR-548h	CLIP-seq
MIRT2315219	hsa-miR-548i	CLIP-seq
MIRT2315220	hsa-miR-548j	CLIP-seq
MIRT2315221	hsa-miR-548k	CLIP-seq
MIRT2315222	hsa-miR-548l	CLIP-seq
MIRT2315223	hsa-miR-548w	CLIP-seq
MIRT2315224	hsa-miR-548y	CLIP-seq
MIRT1305197	hsa-miR-554	CLIP-seq
MIRT2315225	hsa-miR-559	CLIP-seq
MIRT1305198	hsa-miR-561	CLIP-seq
MIRT1305200	hsa-miR-582-3p	CLIP-seq
MIRT1305201	hsa-miR-589	CLIP-seq
MIRT1305202	hsa-miR-597	CLIP-seq
MIRT1305203	hsa-miR-617	CLIP-seq
MIRT1305206	hsa-miR-636	CLIP-seq
MIRT1305207	hsa-miR-637	CLIP-seq
MIRT1305117	hsa-miR-1227	CLIP-seq
MIRT2315202	hsa-miR-302f	CLIP-seq
MIRT2315203	hsa-miR-3152-5p	CLIP-seq
MIRT2315206	hsa-miR-3937	CLIP-seq
MIRT1305174	hsa-miR-4715-3p	CLIP-seq
MIRT2315209	hsa-miR-4735-5p	CLIP-seq
MIRT1305194	hsa-miR-520g	CLIP-seq
MIRT1305195	hsa-miR-520h	CLIP-seq
MIRT1305205	hsa-miR-619	CLIP-seq
MIRT1305127	hsa-miR-200b	CLIP-seq
MIRT1305128	hsa-miR-200c	CLIP-seq
MIRT1305150	hsa-miR-4259	CLIP-seq
MIRT1305152	hsa-miR-429	CLIP-seq
MIRT1305160	hsa-miR-4520a-3p	CLIP-seq
MIRT1305161	hsa-miR-4520b-3p	CLIP-seq
MIRT1305175	hsa-miR-4715-5p	CLIP-seq
MIRT1305186	hsa-miR-4799-5p	CLIP-seq
MIRT1305196	hsa-miR-541	CLIP-seq
MIRT2611490	hsa-miR-1225-3p	CLIP-seq
MIRT1305116	hsa-miR-1226	CLIP-seq
MIRT2611491	hsa-miR-1233	CLIP-seq
MIRT2315200	hsa-miR-1244	CLIP-seq
MIRT1305119	hsa-miR-1257	CLIP-seq
MIRT1305120	hsa-miR-1276	CLIP-seq
MIRT2090328	hsa-miR-1286	CLIP-seq
MIRT1305121	hsa-miR-1301	CLIP-seq
MIRT2611492	hsa-miR-1305	CLIP-seq
MIRT2315201	hsa-miR-142-5p	CLIP-seq
MIRT1305122	hsa-miR-144	CLIP-seq
MIRT1305123	hsa-miR-146a	CLIP-seq
MIRT1305124	hsa-miR-154	CLIP-seq
MIRT2611493	hsa-miR-1587	CLIP-seq
MIRT1305126	hsa-miR-1911	CLIP-seq
MIRT1305127	hsa-miR-200b	CLIP-seq
MIRT1305128	hsa-miR-200c	CLIP-seq
MIRT2090330	hsa-miR-2682	CLIP-seq
MIRT1305130	hsa-miR-300	CLIP-seq
MIRT2315202	hsa-miR-302f	CLIP-seq
MIRT1305131	hsa-miR-3064-3p	CLIP-seq
MIRT2611494	hsa-miR-3065-5p	CLIP-seq
MIRT2611495	hsa-miR-3119	CLIP-seq
MIRT1305132	hsa-miR-3132	CLIP-seq
MIRT1305134	hsa-miR-3150b-3p	CLIP-seq
MIRT2315203	hsa-miR-3152-5p	CLIP-seq
MIRT1305135	hsa-miR-3192	CLIP-seq
MIRT1305136	hsa-miR-3200-3p	CLIP-seq
MIRT1305137	hsa-miR-323-3p	CLIP-seq
MIRT1305138	hsa-miR-326	CLIP-seq
MIRT1305139	hsa-miR-330-5p	CLIP-seq
MIRT2315204	hsa-miR-337-3p	CLIP-seq
MIRT2315205	hsa-miR-340	CLIP-seq
MIRT2611496	hsa-miR-345	CLIP-seq
MIRT2611497	hsa-miR-3609	CLIP-seq
MIRT2611498	hsa-miR-361-5p	CLIP-seq
MIRT1305140	hsa-miR-3616-5p	CLIP-seq
MIRT1305141	hsa-miR-3647-5p	CLIP-seq
MIRT1305142	hsa-miR-3650	CLIP-seq
MIRT2611499	hsa-miR-3653	CLIP-seq
MIRT2611500	hsa-miR-3658	CLIP-seq
MIRT1305143	hsa-miR-3660	CLIP-seq
MIRT2611501	hsa-miR-3662	CLIP-seq
MIRT2611502	hsa-miR-3675-5p	CLIP-seq
MIRT1305144	hsa-miR-3689a-3p	CLIP-seq
MIRT1305145	hsa-miR-3689c	CLIP-seq
MIRT1305146	hsa-miR-381	CLIP-seq
MIRT1305147	hsa-miR-3920	CLIP-seq
MIRT1305148	hsa-miR-3934	CLIP-seq
MIRT1305149	hsa-miR-3935	CLIP-seq
MIRT2315206	hsa-miR-3937	CLIP-seq
MIRT1305150	hsa-miR-4259	CLIP-seq
MIRT2611503	hsa-miR-4267	CLIP-seq
MIRT1305151	hsa-miR-4268	CLIP-seq
MIRT1305152	hsa-miR-429	CLIP-seq
MIRT1305154	hsa-miR-4314	CLIP-seq
MIRT2090337	hsa-miR-4436a	CLIP-seq
MIRT1305156	hsa-miR-4452	CLIP-seq
MIRT1305157	hsa-miR-4496	CLIP-seq
MIRT2090338	hsa-miR-449c	CLIP-seq
MIRT2611504	hsa-miR-4504	CLIP-seq
MIRT1305159	hsa-miR-451b	CLIP-seq
MIRT2090339	hsa-miR-452	CLIP-seq
MIRT1305162	hsa-miR-4526	CLIP-seq
MIRT1305163	hsa-miR-4633-5p	CLIP-seq
MIRT1305165	hsa-miR-4645-3p	CLIP-seq
MIRT1305166	hsa-miR-4646-5p	CLIP-seq
MIRT1305167	hsa-miR-4660	CLIP-seq
MIRT1305168	hsa-miR-4666-3p	CLIP-seq
MIRT1305169	hsa-miR-4667-5p	CLIP-seq
MIRT2611505	hsa-miR-4670-3p	CLIP-seq
MIRT2611506	hsa-miR-4674	CLIP-seq
MIRT2090342	hsa-miR-4676-3p	CLIP-seq
MIRT2611507	hsa-miR-4681	CLIP-seq
MIRT1305170	hsa-miR-4689	CLIP-seq
MIRT2315207	hsa-miR-4699-3p	CLIP-seq
MIRT1305172	hsa-miR-4700-5p	CLIP-seq
MIRT1305174	hsa-miR-4715-3p	CLIP-seq
MIRT1305175	hsa-miR-4715-5p	CLIP-seq
MIRT2315208	hsa-miR-4719	CLIP-seq
MIRT1305176	hsa-miR-4720-3p	CLIP-seq
MIRT1305177	hsa-miR-4727-5p	CLIP-seq
MIRT1305178	hsa-miR-4728-5p	CLIP-seq
MIRT1305179	hsa-miR-4733-3p	CLIP-seq
MIRT2315209	hsa-miR-4735-5p	CLIP-seq
MIRT2611508	hsa-miR-4753-3p	CLIP-seq
MIRT2315210	hsa-miR-4760-3p	CLIP-seq
MIRT1305180	hsa-miR-4762-3p	CLIP-seq
MIRT2611509	hsa-miR-4768-5p	CLIP-seq
MIRT1305181	hsa-miR-4769-3p	CLIP-seq
MIRT2611510	hsa-miR-4777-5p	CLIP-seq
MIRT1305182	hsa-miR-4784	CLIP-seq
MIRT1305183	hsa-miR-4788	CLIP-seq
MIRT1305184	hsa-miR-4789-5p	CLIP-seq
MIRT1305185	hsa-miR-4795-5p	CLIP-seq
MIRT1305186	hsa-miR-4799-5p	CLIP-seq
MIRT2611511	hsa-miR-4802-3p	CLIP-seq
MIRT1305187	hsa-miR-4803	CLIP-seq
MIRT1305188	hsa-miR-4804-3p	CLIP-seq
MIRT1305191	hsa-miR-502-5p	CLIP-seq
MIRT1305192	hsa-miR-504	CLIP-seq
MIRT1305193	hsa-miR-5047	CLIP-seq
MIRT2315211	hsa-miR-513b	CLIP-seq
MIRT2611512	hsa-miR-518d-5p	CLIP-seq
MIRT2611513	hsa-miR-519b-5p	CLIP-seq
MIRT2611514	hsa-miR-519c-5p	CLIP-seq
MIRT2611515	hsa-miR-520c-5p	CLIP-seq
MIRT1305194	hsa-miR-520g	CLIP-seq
MIRT1305195	hsa-miR-520h	CLIP-seq
MIRT2611516	hsa-miR-526a	CLIP-seq
MIRT1305196	hsa-miR-541	CLIP-seq
MIRT2090343	hsa-miR-548a-3p	CLIP-seq
MIRT2315212	hsa-miR-548a-5p	CLIP-seq
MIRT2315213	hsa-miR-548ab	CLIP-seq
MIRT2611517	hsa-miR-548ae	CLIP-seq
MIRT2611518	hsa-miR-548ah	CLIP-seq
MIRT2611519	hsa-miR-548aj	CLIP-seq
MIRT2315214	hsa-miR-548ak	CLIP-seq
MIRT2611520	hsa-miR-548am	CLIP-seq
MIRT2315215	hsa-miR-548b-5p	CLIP-seq
MIRT2315216	hsa-miR-548c-5p	CLIP-seq
MIRT2315217	hsa-miR-548d-5p	CLIP-seq
MIRT2090346	hsa-miR-548e	CLIP-seq
MIRT2090347	hsa-miR-548f	CLIP-seq
MIRT2315218	hsa-miR-548h	CLIP-seq
MIRT2315219	hsa-miR-548i	CLIP-seq
MIRT2315220	hsa-miR-548j	CLIP-seq
MIRT2315221	hsa-miR-548k	CLIP-seq
MIRT2315222	hsa-miR-548l	CLIP-seq
MIRT2611521	hsa-miR-548t	CLIP-seq
MIRT2315223	hsa-miR-548w	CLIP-seq
MIRT2611522	hsa-miR-548x	CLIP-seq
MIRT2315224	hsa-miR-548y	CLIP-seq
MIRT1305197	hsa-miR-554	CLIP-seq
MIRT2315225	hsa-miR-559	CLIP-seq
MIRT2611523	hsa-miR-563	CLIP-seq
MIRT1305199	hsa-miR-573	CLIP-seq
MIRT1305200	hsa-miR-582-3p	CLIP-seq
MIRT2611524	hsa-miR-587	CLIP-seq
MIRT1305201	hsa-miR-589	CLIP-seq
MIRT1305202	hsa-miR-597	CLIP-seq
MIRT1305203	hsa-miR-617	CLIP-seq
MIRT1305204	hsa-miR-618	CLIP-seq
MIRT1305205	hsa-miR-619	CLIP-seq
MIRT2611525	hsa-miR-635	CLIP-seq
MIRT1305207	hsa-miR-637	CLIP-seq
MIRT2090348	hsa-miR-940	CLIP-seq
MIRT2611490	hsa-miR-1225-3p	CLIP-seq
MIRT1305116	hsa-miR-1226	CLIP-seq
MIRT2611491	hsa-miR-1233	CLIP-seq
MIRT2315200	hsa-miR-1244	CLIP-seq
MIRT1305119	hsa-miR-1257	CLIP-seq
MIRT1305120	hsa-miR-1276	CLIP-seq
MIRT2090328	hsa-miR-1286	CLIP-seq
MIRT2611492	hsa-miR-1305	CLIP-seq
MIRT2315201	hsa-miR-142-5p	CLIP-seq
MIRT1305122	hsa-miR-144	CLIP-seq
MIRT1305123	hsa-miR-146a	CLIP-seq
MIRT1305124	hsa-miR-154	CLIP-seq
MIRT2611493	hsa-miR-1587	CLIP-seq
MIRT1305127	hsa-miR-200b	CLIP-seq
MIRT1305128	hsa-miR-200c	CLIP-seq
MIRT2090330	hsa-miR-2682	CLIP-seq
MIRT1305130	hsa-miR-300	CLIP-seq
MIRT2315202	hsa-miR-302f	CLIP-seq
MIRT1305131	hsa-miR-3064-3p	CLIP-seq
MIRT2611494	hsa-miR-3065-5p	CLIP-seq
MIRT2611495	hsa-miR-3119	CLIP-seq
MIRT1305132	hsa-miR-3132	CLIP-seq
MIRT1305134	hsa-miR-3150b-3p	CLIP-seq
MIRT2315203	hsa-miR-3152-5p	CLIP-seq
MIRT1305135	hsa-miR-3192	CLIP-seq
MIRT1305137	hsa-miR-323-3p	CLIP-seq
MIRT1305138	hsa-miR-326	CLIP-seq
MIRT1305139	hsa-miR-330-5p	CLIP-seq
MIRT2315204	hsa-miR-337-3p	CLIP-seq
MIRT2315205	hsa-miR-340	CLIP-seq
MIRT2611496	hsa-miR-345	CLIP-seq
MIRT2611498	hsa-miR-361-5p	CLIP-seq
MIRT1305140	hsa-miR-3616-5p	CLIP-seq
MIRT1305141	hsa-miR-3647-5p	CLIP-seq
MIRT1305142	hsa-miR-3650	CLIP-seq
MIRT2611499	hsa-miR-3653	CLIP-seq
MIRT2611500	hsa-miR-3658	CLIP-seq
MIRT2611501	hsa-miR-3662	CLIP-seq
MIRT2611502	hsa-miR-3675-5p	CLIP-seq
MIRT1305144	hsa-miR-3689a-3p	CLIP-seq
MIRT1305145	hsa-miR-3689c	CLIP-seq
MIRT1305146	hsa-miR-381	CLIP-seq
MIRT1305147	hsa-miR-3920	CLIP-seq
MIRT1305148	hsa-miR-3934	CLIP-seq
MIRT1305149	hsa-miR-3935	CLIP-seq
MIRT2315206	hsa-miR-3937	CLIP-seq
MIRT1305150	hsa-miR-4259	CLIP-seq
MIRT2611503	hsa-miR-4267	CLIP-seq
MIRT1305151	hsa-miR-4268	CLIP-seq
MIRT1305152	hsa-miR-429	CLIP-seq
MIRT1305154	hsa-miR-4314	CLIP-seq
MIRT2090337	hsa-miR-4436a	CLIP-seq
MIRT1305156	hsa-miR-4452	CLIP-seq
MIRT1305157	hsa-miR-4496	CLIP-seq
MIRT2090338	hsa-miR-449c	CLIP-seq
MIRT1305159	hsa-miR-451b	CLIP-seq
MIRT2090339	hsa-miR-452	CLIP-seq
MIRT1305160	hsa-miR-4520a-3p	CLIP-seq
MIRT1305161	hsa-miR-4520b-3p	CLIP-seq
MIRT1305163	hsa-miR-4633-5p	CLIP-seq
MIRT1305165	hsa-miR-4645-3p	CLIP-seq
MIRT1305166	hsa-miR-4646-5p	CLIP-seq
MIRT1305168	hsa-miR-4666-3p	CLIP-seq
MIRT1305169	hsa-miR-4667-5p	CLIP-seq
MIRT2611505	hsa-miR-4670-3p	CLIP-seq
MIRT2611506	hsa-miR-4674	CLIP-seq
MIRT2090342	hsa-miR-4676-3p	CLIP-seq
MIRT2611507	hsa-miR-4681	CLIP-seq
MIRT1305170	hsa-miR-4689	CLIP-seq
MIRT2315207	hsa-miR-4699-3p	CLIP-seq
MIRT1305172	hsa-miR-4700-5p	CLIP-seq
MIRT1305174	hsa-miR-4715-3p	CLIP-seq
MIRT1305175	hsa-miR-4715-5p	CLIP-seq
MIRT2315208	hsa-miR-4719	CLIP-seq
MIRT1305176	hsa-miR-4720-3p	CLIP-seq
MIRT1305178	hsa-miR-4728-5p	CLIP-seq
MIRT1305179	hsa-miR-4733-3p	CLIP-seq
MIRT2315209	hsa-miR-4735-5p	CLIP-seq
MIRT2611508	hsa-miR-4753-3p	CLIP-seq
MIRT2315210	hsa-miR-4760-3p	CLIP-seq
MIRT1305180	hsa-miR-4762-3p	CLIP-seq
MIRT2611509	hsa-miR-4768-5p	CLIP-seq
MIRT2611510	hsa-miR-4777-5p	CLIP-seq
MIRT1305182	hsa-miR-4784	CLIP-seq
MIRT1305183	hsa-miR-4788	CLIP-seq
MIRT1305184	hsa-miR-4789-5p	CLIP-seq
MIRT1305185	hsa-miR-4795-5p	CLIP-seq
MIRT1305186	hsa-miR-4799-5p	CLIP-seq
MIRT2611511	hsa-miR-4802-3p	CLIP-seq
MIRT1305187	hsa-miR-4803	CLIP-seq
MIRT1305188	hsa-miR-4804-3p	CLIP-seq
MIRT1305191	hsa-miR-502-5p	CLIP-seq
MIRT1305192	hsa-miR-504	CLIP-seq
MIRT2315211	hsa-miR-513b	CLIP-seq
MIRT2611512	hsa-miR-518d-5p	CLIP-seq
MIRT2611513	hsa-miR-519b-5p	CLIP-seq
MIRT2611514	hsa-miR-519c-5p	CLIP-seq
MIRT2611515	hsa-miR-520c-5p	CLIP-seq
MIRT1305194	hsa-miR-520g	CLIP-seq
MIRT1305195	hsa-miR-520h	CLIP-seq
MIRT2611516	hsa-miR-526a	CLIP-seq
MIRT1305196	hsa-miR-541	CLIP-seq
MIRT2090343	hsa-miR-548a-3p	CLIP-seq
MIRT2315212	hsa-miR-548a-5p	CLIP-seq
MIRT2315213	hsa-miR-548ab	CLIP-seq
MIRT2611517	hsa-miR-548ae	CLIP-seq
MIRT2611519	hsa-miR-548aj	CLIP-seq
MIRT2315214	hsa-miR-548ak	CLIP-seq
MIRT2611520	hsa-miR-548am	CLIP-seq
MIRT2315215	hsa-miR-548b-5p	CLIP-seq
MIRT2315216	hsa-miR-548c-5p	CLIP-seq
MIRT2315217	hsa-miR-548d-5p	CLIP-seq
MIRT2090346	hsa-miR-548e	CLIP-seq
MIRT2090347	hsa-miR-548f	CLIP-seq
MIRT2315218	hsa-miR-548h	CLIP-seq
MIRT2315219	hsa-miR-548i	CLIP-seq
MIRT2315220	hsa-miR-548j	CLIP-seq
MIRT2315221	hsa-miR-548k	CLIP-seq
MIRT2315222	hsa-miR-548l	CLIP-seq
MIRT2315223	hsa-miR-548w	CLIP-seq
MIRT2611522	hsa-miR-548x	CLIP-seq
MIRT2315224	hsa-miR-548y	CLIP-seq
MIRT1305197	hsa-miR-554	CLIP-seq
MIRT2315225	hsa-miR-559	CLIP-seq
MIRT2611523	hsa-miR-563	CLIP-seq
MIRT1305199	hsa-miR-573	CLIP-seq
MIRT1305200	hsa-miR-582-3p	CLIP-seq
MIRT2611524	hsa-miR-587	CLIP-seq
MIRT1305201	hsa-miR-589	CLIP-seq
MIRT1305202	hsa-miR-597	CLIP-seq
MIRT1305203	hsa-miR-617	CLIP-seq
MIRT1305205	hsa-miR-619	CLIP-seq
MIRT2611525	hsa-miR-635	CLIP-seq
MIRT1305207	hsa-miR-637	CLIP-seq
MIRT2090348	hsa-miR-940	CLIP-seq

Transcription factors

Show/Hide all(2)

Transcription factor	Regulation	Reference
PTTG1	Activation	22081074
STAT6	Activation	19857574

Show/Hide all(156)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000281	Process	Mitotic cytokinesis	IEA
GO:0000902	Process	Cell morphogenesis	IEA
GO:0001764	Process	Neuron migration	IEA
GO:0001822	Process	Kidney development	IEA
GO:0001998	Process	Angiotensin-mediated vasoconstriction involved in regulation of systemic arterial blood pressure	IEA
GO:0002363	Process	Alpha-beta T cell lineage commitment	IEA
GO:0003100	Process	Regulation of systemic arterial blood pressure by endothelin	IEA
GO:0003189	Process	Aortic valve formation	IGI	26188246
GO:0003924	Function	GTPase activity	EXP	18829532
GO:0003924	Function	GTPase activity	IBA
GO:0003924	Function	GTPase activity	IDA	19734146, 19787194, 26529257, 27917469
GO:0003924	Function	GTPase activity	IEA
GO:0003924	Function	GTPase activity	TAS	10436159
GO:0003925	Function	G protein activity	IDA	21565175, 23940119
GO:0003925	Function	G protein activity	IEA
GO:0005515	Function	Protein binding	IPI	9214622, 10051605, 10066731, 10489445, 11067852, 11335720, 11889037, 11927263, 12006984, 12879077, 14660612, 15364580, 15530360, 15644318, 16189514, 17115030, 18218625, 18256687, 19470470, 19887681, 19944695, 20195357, 20300064, 20348415, 20711218, 20974804, 21029865, 21281639, 2170
GO:0005525	Function	GTP binding	IBA
GO:0005525	Function	GTP binding	IDA	12777804, 15601624
GO:0005525	Function	GTP binding	IEA
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005768	Component	Endosome	IMP	19887681
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA	1328215
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0005938	Component	Cell cortex	IDA	16103226
GO:0005938	Component	Cell cortex	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0007010	Process	Cytoskeleton organization	IEA
GO:0007155	Process	Cell adhesion	IEA
GO:0007160	Process	Cell-matrix adhesion	IEA
GO:0007264	Process	Small GTPase-mediated signal transduction	IEA
GO:0007266	Process	Rho protein signal transduction	IBA
GO:0007266	Process	Rho protein signal transduction	IDA	21565175, 26529257
GO:0007266	Process	Rho protein signal transduction	IEA
GO:0007266	Process	Rho protein signal transduction	IMP	23241886, 31570889
GO:0007266	Process	Rho protein signal transduction	ISS
GO:0007266	Process	Rho protein signal transduction	TAS	10436159
GO:0007519	Process	Skeletal muscle tissue development	IEA
GO:0009898	Component	Cytoplasmic side of plasma membrane	IDA	1328215
GO:0010812	Process	Negative regulation of cell-substrate adhesion	IEA
GO:0010812	Process	Negative regulation of cell-substrate adhesion	ISS
GO:0010975	Process	Regulation of neuron projection development	IEA
GO:0016020	Component	Membrane	IEA
GO:0016477	Process	Cell migration	IBA
GO:0016477	Process	Cell migration	IDA	26529257
GO:0016477	Process	Cell migration	IGI	26188246
GO:0016477	Process	Cell migration	IMP	19782033
GO:0016787	Function	Hydrolase activity	IEA
GO:0017022	Function	Myosin binding	IPI	15644318
GO:0019901	Function	Protein kinase binding	IBA
GO:0021762	Process	Substantia nigra development	HEP	22926577
GO:0021795	Process	Cerebral cortex cell migration	IEA
GO:0021861	Process	Forebrain radial glial cell differentiation	IEA
GO:0030027	Component	Lamellipodium	IEA
GO:0030027	Component	Lamellipodium	ISS
GO:0030036	Process	Actin cytoskeleton organization	IEA
GO:0030036	Process	Actin cytoskeleton organization	IMP	19782033
GO:0030036	Process	Actin cytoskeleton organization	TAS	10436159
GO:0030054	Component	Cell junction	TAS
GO:0030154	Process	Cell differentiation	IEA
GO:0030334	Process	Regulation of cell migration	IMP	19934221
GO:0030335	Process	Positive regulation of cell migration	IEA
GO:0030425	Component	Dendrite	IEA
GO:0030496	Component	Midbody	IEA
GO:0030521	Process	Androgen receptor signaling pathway	IEA
GO:0030667	Component	Secretory granule membrane	TAS
GO:0031122	Process	Cytoplasmic microtubule organization	IMP	31570889
GO:0031982	Component	Vesicle	IDA	19887681
GO:0032154	Component	Cleavage furrow	IDA	16103226
GO:0032154	Component	Cleavage furrow	IEA
GO:0032467	Process	Positive regulation of cytokinesis	IMP	16103226, 17115030
GO:0032587	Component	Ruffle membrane	IEA
GO:0032956	Process	Regulation of actin cytoskeleton organization	IBA
GO:0032956	Process	Regulation of actin cytoskeleton organization	IDA	25911094
GO:0032956	Process	Regulation of actin cytoskeleton organization	IEA
GO:0033144	Process	Negative regulation of intracellular steroid hormone receptor signaling pathway	IEA
GO:0033688	Process	Regulation of osteoblast proliferation	IEA
GO:0033688	Process	Regulation of osteoblast proliferation	ISS
GO:0034329	Process	Cell junction assembly	IMP	22891260
GO:0034446	Process	Substrate adhesion-dependent cell spreading	IMP	31570889
GO:0035385	Process	Roundabout signaling pathway	IDA	26529257
GO:0036089	Process	Cleavage furrow formation	IDA	16103226
GO:0038027	Process	Apolipoprotein A-I-mediated signaling pathway	IMP	23726972
GO:0042476	Process	Odontogenesis	IEA
GO:0042995	Component	Cell projection	IEA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IEP	12761501
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IMP	25515214
GO:0043149	Process	Stress fiber assembly	IBA
GO:0043149	Process	Stress fiber assembly	IEA
GO:0043149	Process	Stress fiber assembly	IMP	19782033, 31570889
GO:0043197	Component	Dendritic spine	IBA
GO:0043296	Component	Apical junction complex	IDA	20974804
GO:0043297	Process	Apical junction assembly	IEA
GO:0043297	Process	Apical junction assembly	IMP	20974804
GO:0043366	Process	Beta selection	IEA
GO:0043542	Process	Endothelial cell migration	IGI	20208559
GO:0043931	Process	Ossification involved in bone maturation	IEA
GO:0043931	Process	Ossification involved in bone maturation	ISS
GO:0044319	Process	Wound healing, spreading of cells	ISS
GO:0045198	Process	Establishment of epithelial cell apical/basal polarity	IMP	22891260
GO:0045666	Process	Positive regulation of neuron differentiation	IMP	17488780
GO:0045792	Process	Negative regulation of cell size	IMP	8625410
GO:0046638	Process	Positive regulation of alpha-beta T cell differentiation	IEA
GO:0050919	Process	Negative chemotaxis	IMP	23726972
GO:0051301	Process	Cell division	IEA
GO:0051496	Process	Positive regulation of stress fiber assembly	IDA	15467718
GO:0051496	Process	Positive regulation of stress fiber assembly	IEA
GO:0051496	Process	Positive regulation of stress fiber assembly	IMP	8625410
GO:0051893	Process	Regulation of focal adhesion assembly	TAS	18981818
GO:0060071	Process	Wnt signaling pathway, planar cell polarity pathway	NAS	24431302
GO:0060193	Process	Positive regulation of lipase activity	IDA	19887681
GO:0060193	Process	Positive regulation of lipase activity	IMP	22740689
GO:0061430	Process	Bone trabecula morphogenesis	IEA
GO:0061430	Process	Bone trabecula morphogenesis	ISS
GO:0070062	Component	Extracellular exosome	HDA	19056867, 20458337
GO:0070507	Process	Regulation of microtubule cytoskeleton organization	IEA
GO:0071222	Process	Cellular response to lipopolysaccharide	IDA	19734146
GO:0071345	Process	Cellular response to cytokine stimulus	IMP	25515214
GO:0071526	Process	Semaphorin-plexin signaling pathway	IEA
GO:0071526	Process	Semaphorin-plexin signaling pathway	ISS
GO:0071803	Process	Positive regulation of podosome assembly	IEA
GO:0071902	Process	Positive regulation of protein serine/threonine kinase activity	IDA	8617235
GO:0071944	Component	Cell periphery	IMP	25911094
GO:0090051	Process	Negative regulation of cell migration involved in sprouting angiogenesis	IGI	20208559
GO:0090307	Process	Mitotic spindle assembly	IMP	19635168
GO:0090324	Process	Negative regulation of oxidative phosphorylation	IEA
GO:0097049	Process	Motor neuron apoptotic process	IEA
GO:0097498	Process	Endothelial tube lumen extension	IGI	20208559
GO:0098794	Component	Postsynapse	IDA	21423166, 24352656
GO:0098794	Component	Postsynapse	IMP	21423166, 24352656
GO:0098978	Component	Glutamatergic synapse	IDA	21423166, 24352656
GO:0098978	Component	Glutamatergic synapse	IMP	21423166, 24352656
GO:0099159	Process	Regulation of modification of postsynaptic structure	IDA	21423166
GO:0099159	Process	Regulation of modification of postsynaptic structure	IMP	21423166
GO:0101003	Component	Ficolin-1-rich granule membrane	TAS
GO:1901224	Process	Positive regulation of non-canonical NF-kappaB signal transduction	NAS	12761501
GO:1902766	Process	Skeletal muscle satellite cell migration	ISS
GO:1903427	Process	Negative regulation of reactive oxygen species biosynthetic process	IEA
GO:1903673	Process	Mitotic cleavage furrow formation	IMP	16103226
GO:1904695	Process	Positive regulation of vascular associated smooth muscle contraction	IEA
GO:1904996	Process	Positive regulation of leukocyte adhesion to vascular endothelial cell	IMP	25515214
GO:1905274	Process	Regulation of modification of postsynaptic actin cytoskeleton	IDA	21423166
GO:1905274	Process	Regulation of modification of postsynaptic actin cytoskeleton	IMP	21423166
GO:1990869	Process	Cellular response to chemokine	IMP	23241886
GO:2000177	Process	Regulation of neural precursor cell proliferation	IEA
GO:2000406	Process	Positive regulation of T cell migration	IMP	23241886
GO:2000672	Process	Negative regulation of motor neuron apoptotic process	IEA

MIM	HGNC	e!Ensembl
165390	667	ENSG00000067560

Protein

UniProt ID

P61586

Protein name

Transforming protein RhoA (EC 3.6.5.2) (Rho cDNA clone 12) (h12)

Protein function

Small GTPase which cycles between an active GTP-bound and an inactive GDP-bound state. Mainly associated with cytoskeleton organization, in active state binds to a variety of effector proteins to regulate cellular responses such as cytoskeletal

PDB

1A2B , 1CC0 , 1CXZ , 1DPF , 1FTN , 1KMQ , 1LB1 , 1OW3 , 1S1C , 1TX4 , 1X86 , 1XCG , 2RGN , 3KZ1 , 3LW8 , 3LWN , 3LXR , 3MSX , 3T06 , 4D0N , 4XH9 , 4XOI , 4XSG , 4XSH , 5A0F , 5BWM , 5C2K , 5C4M , 5EZ6 , 5FR1 , 5FR2 , 5HPY , 5IRC , 5JCP , 5JHG , 5JHH , 5M6X , 5M70 , 5ZHX , 6BC0 , 6BCA , 6BCB , 6KX2 , 6KX3 , 6R3V , 6V6M , 6V6U , 6V6V , 7G80 , 7G81 , 7G82

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00071	Ras	7 → 180	Ras family	Domain

Sequence

MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT
AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD
LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ
ARRGKKKSGCLVL

Sequence length

193

Interactions

View interactions

	KEGG		Reactome
	Ras signaling pathway Rap1 signaling pathway cGMP-PKG signaling pathway cAMP signaling pathway Chemokine signaling pathway Sphingolipid signaling pathway Phospholipase D signaling pathway Hormone signaling Endocytosis mTOR signaling pathway Vascular smooth muscle contraction Wnt signaling pathway TGF-beta signaling pathway Axon guidance Focal adhesion Adherens junction Tight junction Platelet activation NOD-like receptor signaling pathway C-type lectin receptor signaling pathway T cell receptor signaling pathway Leukocyte transendothelial migration Neurotrophin signaling pathway Regulation of actin cytoskeleton Oxytocin signaling pathway Parathyroid hormone synthesis, secretion and action Pancreatic secretion Bacterial invasion of epithelial cells Pathogenic Escherichia coli infection Shigellosis Salmonella infection Pertussis Yersinia infection Tuberculosis Human cytomegalovirus infection Pathways in cancer Viral carcinogenesis Proteoglycans in cancer MicroRNAs in cancer Colorectal cancer Lipid and atherosclerosis Fluid shear stress and atherosclerosis		GPVI-mediated activation cascade Axonal growth inhibition (RHOA activation) Rho GTPase cycle PI3K/AKT activation Axonal growth stimulation TGF-beta receptor signaling in EMT (epithelial to mesenchymal transition) G beta:gamma signalling through PI3Kgamma EPHB-mediated forward signaling EPHA-mediated growth cone collapse PCP/CE pathway G alpha (12/13) signalling events Sema4D mediated inhibition of cell attachment and migration Sema4D induced cell migration and growth-cone collapse VEGFA-VEGFR2 Pathway RHO GTPases activate PKNs RHO GTPases activate CIT RHO GTPases activate KTN1 RHO GTPases Activate ROCKs RHO GTPases Activate Formins RHO GTPases Activate Rhotekin and Rhophilins Ovarian tumor domain proteases ERBB2 Regulates Cell Motility Neutrophil degranulation PTK6 Regulates RHO GTPases, RAS GTPase and MAP kinases SLIT2:ROBO1 increases RHOA activity

Show/Hide Causal Diseases (2)

Disease merge term	Disease name	dbSNP ID	References
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Ectodermal Dysplasia	Ectodermal dysplasia with facial dysmorphism and acral, ocular, and brain anomalies	rs1575653629, rs1575647025	N/A
Congenital Hemihypertrophy	Hemihypertrophy	rs1575653629	N/A

Show/Hide Unknown Diseases (4)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Coronary artery disease	Coronary artery disease	N/A	N/A	GWAS
Inflammatory Bowel Disease	Inflammatory bowel disease (MTAG)	N/A	N/A	GWAS
Myocardial Infarction	Myocardial infarction	N/A	N/A	GWAS
neoplasm	Neoplasm	N/A	N/A	ClinVar

Show/Hide Text Mining Associations (232)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Abnormalities Drug Induced	Associate	22251897
Acute Aortic Syndrome	Associate	35804020
Adenocarcinoma	Associate	23200924, 30425335, 38584451
Adenocarcinoma of Lung	Associate	34748526, 36453714
Adenoma	Associate	26313302
Adenoma	Inhibit	31506480
Adenomyosis	Associate	30387365
Alopecia	Associate	31570889
Alzheimer Disease	Associate	28558704, 34326892
Anemia Sickle Cell	Inhibit	22982429
Anemia Sickle Cell	Associate	22982429
Antiphospholipid Syndrome	Associate	18759277, 38155384
Arrhythmogenic Right Ventricular Dysplasia	Associate	33670616
Arteriosclerosis Obliterans	Associate	25445891
Arthritis Rheumatoid	Associate	27498552
Asthma	Associate	20006706, 20859068
Astrocytoma	Associate	24333506
Atherosclerosis	Associate	25740292
Atrial Fibrillation	Associate	33834070
Attention Deficit Disorder with Hyperactivity	Associate	27004716
Bernard Soulier Syndrome	Associate	40045897
Beta ketothiolase deficiency	Associate	26251521
Bisphosphonate Associated Osteonecrosis of the Jaw	Associate	35035862
Brain Ischemia	Associate	35760846
Breast Neoplasms	Associate	12237774, 12771933, 15843433, 17332506, 18493596, 19533666, 19550117, 19815594, 20503409, 20655307, 20843787, 22002306, 22655072, 22992742, 23176180 View all (22 more)
Burkitt Lymphoma	Associate	26468873
Calcinosis Cutis	Associate	31324164, 33897882, 36509758
Carcinogenesis	Associate	18445682, 18505685, 18751372, 20503409, 24351810, 26066055, 26409448, 29949791, 32154766, 33388549
Carcinoma Basal Cell	Associate	33162807
Carcinoma Hepatocellular	Associate	18781093, 24498348, 24992599, 25238232, 25472720, 26846339, 27831648, 28695771, 31324164, 32955083, 35941537, 38341081
Carcinoma Hepatocellular	Stimulate	31339860, 34469466
Carcinoma Non Small Cell Lung	Associate	21779788, 25120748, 30535445, 32495879, 32672788, 33269380, 35978057, 36207695
Carcinoma Non Small Cell Lung	Inhibit	23571382
Carcinoma Ovarian Epithelial	Associate	17314270, 24351810, 29949791, 30795761
Carcinoma Pancreatic Ductal	Associate	26483550, 26530532
Carcinoma Renal Cell	Inhibit	18751372
Carcinoma Renal Cell	Associate	23521319, 25343250, 26066055, 26177500, 30872677, 35373928, 36812376, 37298689
Carcinoma Small Cell	Associate	36812376
Carcinoma Squamous Cell	Stimulate	26409448
Carcinoma Squamous Cell	Associate	30232004, 31976530
Cardiac Tamponade	Associate	35732446
Cardiovascular Diseases	Associate	26240115, 29735721
Celiac Disease	Associate	23982754
Cholesteatoma	Associate	35177391
Chromosomal Instability	Associate	35484119
Cleft Lip	Associate	34024335, 40414526
Cleft Palate	Stimulate	34024335
Cleft Palate	Associate	40414526
Colonic Diseases	Associate	23437299
Colorectal Neoplasms	Associate	18922976, 19374769, 21430067, 21968138, 24958816, 27249601, 27333992, 27888624, 28146427, 28492141, 29206819, 30296500, 30846413, 33037251, 35647190, 36982429, 37193711 View all (2 more)
Colorectal Neoplasms	Inhibit	26261596
Corneal Endothelial Cell Loss	Associate	20181950
Coronary Vasospasm	Associate	35096275
COVID 19	Associate	34578338
Crohn Disease	Associate	33973626, 36812376
Crohn Disease	Inhibit	36444838
Cystic Fibrosis	Stimulate	12948935
Cystic Fibrosis	Associate	17499483, 29239766
Cytomegalovirus Infections	Associate	32749463
Dermatitis Atopic	Associate	29498756
Developmental Disabilities	Associate	40414526
Diabetes Complications	Associate	35806251
Diabetes Mellitus	Associate	19754670, 22694757, 35592524
Diabetes Mellitus	Stimulate	37182870
Diabetes Mellitus Type 2	Inhibit	24642103
Diabetic Angiopathies	Associate	22694757
Diabetic Nephropathies	Associate	32778679
Diabetic Retinopathy	Associate	29786744
digital ulcers	Associate	40414526
Drug Hypersensitivity	Associate	20859068
Drug Related Side Effects and Adverse Reactions	Inhibit	32085741
Dysmenorrhea	Associate	30387365
Eales disease	Associate	17947237
Ectodermal Dysplasia	Associate	40414526
Ectrodactyly cleft lip palate syndrome	Associate	40414526
Ectrodactyly Ectodermal Dysplasia And Cleft Lip Palate Syndrome 1	Associate	40414526
Encephalitis	Associate	22586486
Endometrial Neoplasms	Associate	30387365, 32457342, 39297944
Endometriosis	Associate	24551285
Esophageal Squamous Cell Carcinoma	Associate	31054987
Facial Dysmorphism with Multiple Malformations	Associate	40414526
Fibrocartilaginous embolism	Associate	24441571, 33415745
Fibrosis	Stimulate	29995590, 34469466
Fibrosis	Associate	36440854
Finger Injuries	Associate	40414526
Glioblastoma	Associate	17951409, 26459764, 26741994, 29115617, 29207169, 30886866, 32693062, 32945485, 34376733, 34638872, 35639414, 37427593, 39390804
Glioma	Associate	15992376, 17951409, 23577178
Glucocorticoid Receptor Deficiency	Associate	34262023
Glut1 Deficiency Syndrome	Associate	23963366
Graft vs Host Disease	Associate	20018869
Graves Ophthalmopathy	Associate	35937945
Heart Diseases	Associate	29928977
Hemangioma Cavernous Central Nervous System	Associate	19318350, 20181950
Hemostatic Disorders	Associate	20629659
Hereditary Breast and Ovarian Cancer Syndrome	Associate	19451088
Herpes Simplex	Stimulate	34469037
Hyperglycemia	Stimulate	23963366
Hyperinsulinism	Associate	10930411
Hypertelorism	Associate	40414526
Hypertension	Associate	22430126, 26066055, 26100637
Hypertension Pulmonary	Associate	25853972
Hypesthesia	Associate	29593724
Hypopharyngeal Neoplasms	Associate	27469492
Hypopigmentation	Associate	31570889, 35178721
Hypoxia	Stimulate	17332506, 30535445, 31931758, 32671953, 35484119
Hypoxia	Associate	21357506
Hypoxia	Inhibit	28254846
Hypoxia Brain	Inhibit	31698752
Idiopathic Pulmonary Fibrosis	Associate	16776827, 29995590
Idiopathic Pulmonary Fibrosis	Inhibit	35222396
IgA Vasculitis	Associate	17075836
Immunologic Deficiency Syndromes	Stimulate	22965878
Impotence Vasculogenic	Associate	32672788
Infarction	Inhibit	35760846
Inflammation	Associate	17075836, 20503409, 21410486, 30536538, 32945445, 35096275, 38155384
Inflammatory Bowel Diseases	Associate	17218473
Insulin Resistance	Associate	35806251
Intellectual Disability	Associate	40414526
Interleukin 2 Receptor Alpha Deficiency of	Associate	22736314
Intraocular Lymphoma	Associate	25637523
Ischemia	Inhibit	35760846
Ischemic Stroke	Associate	32945445
Kidney Diseases	Associate	40414526
Kidney Failure Chronic	Associate	30212930
Kidney Neoplasms	Associate	18567581
Lead Poisoning Nervous System	Associate	35170371
Leiomyoma	Associate	23023061
Leprosy	Associate	29593724
Leukemia	Associate	11373293, 15331592, 30217930, 30568170
Leukemia Large Granular Lymphocytic	Associate	23667543
Leukemia Lymphocytic Chronic B Cell	Associate	20488224
Leukemia Lymphoma Adult T Cell	Associate	26574607, 26847067, 33426772
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	22443473, 24098519
Leukemia Myeloid Acute	Associate	24280143, 25494542, 34792179
Leukoencephalopathies	Associate	31570889
Liver Cirrhosis	Associate	35357779
Long QT Syndrome	Associate	20629659
Lower Urinary Tract Symptoms	Associate	28855187
Lung Neoplasms	Associate	19154401, 19568240, 25120748, 25869366, 27802291, 28487954, 32495879, 34321041, 35538035, 36509758
Lupus Erythematosus Systemic	Associate	22736314
Lupus Erythematosus Systemic	Stimulate	38243295
Lymphangioleiomyomatosis	Associate	16388022
Lymphatic Metastasis	Inhibit	23420497
Lymphatic Metastasis	Associate	25120748, 37132640
Lymphatic Metastasis	Stimulate	26409448
Lymphoma	Associate	20844236, 25310466, 33567811
Lymphoma B Cell Marginal Zone	Associate	35064935, 35528192
Lymphoma Non Hodgkin	Associate	25823974
Lymphoma T Cell	Associate	24413734, 25310466, 25791160, 26719098, 27369867, 28148900, 28157189, 28832024, 29493850, 31859368, 32484856, 32945366, 33406263, 33567811, 33716241 View all (5 more)
Lymphoma T Cell Peripheral	Associate	24413734, 25310466, 26268241, 29493850, 30829413, 31859368, 32484856, 33567811, 36093687
Melanoma	Associate	19293150, 21917148, 23859498, 26823948, 26828592, 27549189, 27818281, 29048609, 31659259, 32085741, 33402468, 35440004
Melanoma Cutaneous Malignant	Associate	37960805
Meningitis Aseptic	Associate	22586486
Menorrhagia	Associate	30387365
Mental Disorders	Associate	25695269
Mesothelioma Malignant	Associate	26554828, 36323745
Mevalonate Kinase Deficiency	Associate	20814828, 25107911, 38636615
Mitochondrial Diseases	Inhibit	28254846
Mouth Neoplasms	Associate	28886265
Moyamoya Disease	Associate	40634490
Multiple Myeloma	Associate	14504085, 18923442
Multiple Sclerosis	Inhibit	32763844
Multiple Sclerosis	Associate	33795012
Muscle Neoplasms	Associate	36194662
Myocardial Infarction	Associate	31698570
Myopathy with Giant Abnormal Mitochondria	Associate	30999892
Nasopharyngeal Carcinoma	Associate	33155211
Neoplasm Metastasis	Associate	19154401, 19550117, 21430067, 22002306, 25019574, 25120748, 26409448, 26483550, 26811494, 27713154, 29432180, 29687789, 29752407, 30674565, 31324164 View all (7 more)
Neoplasm Metastasis	Inhibit	22289355, 23420497
Neoplasm Metastasis	Stimulate	31976530, 37298689
Neoplasms	Stimulate	11568556, 22992742, 28624843, 29949791
Neoplasms	Associate	12237774, 12808121, 15713677, 17332506, 18541705, 18827818, 19151751, 19372585, 19374769, 20503409, 21779788, 21943101, 22965878, 23593363, 23868972 View all (46 more)
Neoplasms	Inhibit	24992599, 29206819
Neoplasms Cystic Mucinous and Serous	Stimulate	12808121
Nerve Degeneration	Associate	22586486
Neuralgia	Associate	29593724
Neurocutaneous Syndromes	Associate	31570889, 40414526
Neuroendocrine Tumors	Associate	22504159, 27802291
Neuromuscular Diseases	Associate	37353484
Neutropenia Severe Congenital Autosomal Recessive 3	Associate	10779444
Niemann Pick Disease Type C	Associate	17499483
Obesity	Associate	36194662
Oculocerebrorenal Syndrome	Associate	20629659
Osteoporosis	Associate	27153759
Osteosarcoma	Associate	19635168, 29751634
Ovarian Diseases	Associate	24351810
Ovarian Neoplasms	Associate	12808121, 21643014, 22610942, 23042265, 24351810, 29642915, 33423701, 33685573
Ovarian Neoplasms	Stimulate	29949791
Pain	Associate	29593724
Pancreatic Neoplasms	Associate	23322732, 25019574, 26483550, 26747707, 27145964, 35277915
Pelvic Organ Prolapse	Associate	25692679
Pemphigus	Inhibit	24711455
Pericardial Effusion	Associate	35732446
Persistent Mullerian duct syndrome	Associate	24413734
Pituitary dwarfism 1	Associate	25485589
Plaque Amyloid	Associate	32854643
Polycystic Ovary Syndrome	Associate	28949383
Pre Eclampsia	Associate	36160709
Precancerous Conditions	Associate	30872677
Priapism	Associate	22982429
Prion Diseases	Associate	40414526
Prostatic Neoplasms	Associate	17658517, 22504159, 23773523, 28184030, 29330286, 33897882
Pterygium	Stimulate	31547113
Respiratory Distress Syndrome	Associate	32763844
Robinow Syndrome	Associate	31570889
Sarcoma Ewing	Associate	35484119
Sarcoma Kaposi	Associate	25569678
Spinal Muscular Atrophies of Childhood	Associate	32558393
Squamous Cell Carcinoma of Head and Neck	Associate	11568556, 17018591, 20805359, 28886265
Squamous Intraepithelial Lesions	Stimulate	22443139
Stenosis Pulmonary Vein	Associate	12208777
Stomach Neoplasms	Associate	17659701, 18231637, 18300342, 18827818, 19372585, 24351810, 25079317, 25823974, 26251521, 26811494, 26830684, 27756879, 27904131, 28624843, 28836853 View all (10 more)
Stroke	Associate	22167233
Subarachnoid Hemorrhage	Stimulate	29735721
Syndactyly type 3	Associate	40414526
Tachycardia	Associate	26774166
Tertiary Lymphoid Structures	Stimulate	26142737
Thrombosis	Associate	18759277
Thyroid Carcinoma Anaplastic	Inhibit	29236027
Tongue Neoplasms	Associate	37132640
Triple Negative Breast Neoplasms	Associate	31836816, 33205415
Tuberculosis Multidrug Resistant	Stimulate	23593363
Tuberous Sclerosis	Associate	33972524
Urinary Bladder Neoplasms	Associate	32705161, 34285193
Uterine Cervical Neoplasms	Associate	20429915, 31976530, 36300671
Vaginal Neoplasms	Associate	28843271
Vascular Diseases	Associate	20530044, 22251897
Vascular System Injuries	Associate	26100637, 30536538
Vasculitis	Associate	29993181
Vasospasm Intracranial	Associate	29735721
Virus Diseases	Associate	10373471
Vulvar Neoplasms	Associate	26409448

RHOA (ras homolog family member A)