Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	386681
Gene name Gene Name - the full gene name approved by the HGNC.	Keratin associated protein 10-8
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	KRTAP10-8
Synonyms (NCBI Gene) Gene synonyms aliases	KAP10.8, KRTAP18-8, KRTAP18.8
Chromosome Chromosome number	21
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	21q22.3

Show/Hide all(26)

miRTarBase ID	miRNA	Experiments
MIRT2027731	hsa-miR-1207-3p	CLIP-seq
MIRT2027732	hsa-miR-3176	CLIP-seq
MIRT2027733	hsa-miR-378	CLIP-seq
MIRT2027734	hsa-miR-378b	CLIP-seq
MIRT2027735	hsa-miR-378c	CLIP-seq
MIRT2027736	hsa-miR-378d	CLIP-seq
MIRT2027737	hsa-miR-378e	CLIP-seq
MIRT2027738	hsa-miR-378f	CLIP-seq
MIRT2027739	hsa-miR-378h	CLIP-seq
MIRT2027740	hsa-miR-378i	CLIP-seq
MIRT2027741	hsa-miR-3922-3p	CLIP-seq
MIRT2027742	hsa-miR-422a	CLIP-seq
MIRT2027743	hsa-miR-4468	CLIP-seq
MIRT2027744	hsa-miR-646	CLIP-seq
MIRT2027732	hsa-miR-3176	CLIP-seq
MIRT2027733	hsa-miR-378	CLIP-seq
MIRT2027734	hsa-miR-378b	CLIP-seq
MIRT2027735	hsa-miR-378c	CLIP-seq
MIRT2027736	hsa-miR-378d	CLIP-seq
MIRT2027737	hsa-miR-378e	CLIP-seq
MIRT2027738	hsa-miR-378f	CLIP-seq
MIRT2027739	hsa-miR-378h	CLIP-seq
MIRT2027740	hsa-miR-378i	CLIP-seq
MIRT2027741	hsa-miR-3922-3p	CLIP-seq
MIRT2027742	hsa-miR-422a	CLIP-seq
MIRT2027743	hsa-miR-4468	CLIP-seq

Show/Hide all(5)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	25416956, 25910212, 26871637, 29892012, 31515488, 32296183
GO:0005829	Component	Cytosol	TAS
GO:0031424	Process	Keratinization	TAS
GO:0042802	Function	Identical protein binding	IPI	25416956, 32296183
GO:0045095	Component	Keratin filament	IEA

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Protein

UniProt ID

P60410

Protein name

Keratin-associated protein 10-8 (High sulfur keratin-associated protein 10.8) (Keratin-associated protein 10.8) (Keratin-associated protein 18-8) (Keratin-associated protein 18.8)

Protein function

In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their e

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF05287	PMG	2 → 91	PMG protein	Family
PF13885	Keratin_B2_2	140 → 186	Keratin, high sulfur B2 protein	Family
PF13885	Keratin_B2_2	178 → 216	Keratin, high sulfur B2 protein	Family

Tissue specificity

TISSUE SPECIFICITY: Restricted to a narrow region of the hair fiber cuticle, lying approximately 20 cell layers above the apex of the dermal papilla of the hair root; not detected in any other tissues. {ECO:0000269|PubMed:14962103, ECO:0000269|PubMed:1502

Sequence

MADACCTRTYVIAASTMSVCSSDVGHVSRVSSPSTCTGSSWQVDNCQESCCEPRSCASSC
CTPSCCAPAPCLALVCAPVSCEPSPCQSGCTDSCTPSCCQQSSCQPACCTSSPCQQACCV
PVCCKSNCCKPVCCVSICSGASSPCCQQSSCQSACCTFSPCQQACCVPICCKPICCVPVC
SGASSLCCQKSSCQPACCTTSCCRPSSSVSLLCRPVCRPACCVPVPSCCVPASSCQPSCC
HPASCLSFLCRPACSRLAC

Sequence length

259

Interactions

View interactions

	Reactome
			Keratinization

Show/Hide Causal Diseases (2)

Disease term	Disease name	dbSNP ID
Causal
Breast cancer	Malignant neoplasm of breast	rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158 View all (309 more)
Colorectal cancer	Colorectal Carcinoma	rs137854568, rs137854573, rs137854575, rs387906234, rs121908380, rs121908702, rs267606674, rs794729661, rs121909055, rs281865417, rs267606884, rs28934575, rs587776769, rs104893815, rs587776800 View all (467 more)

KRTAP10-8 (keratin associated protein 10-8)