Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
3857
Gene name Gene Name - the full gene name approved by the HGNC.
Keratin 9
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
KRT9
Synonyms (NCBI Gene) Gene synonyms aliases
CK-9, EPPK, EPPK1, K9
Chromosome Chromosome number
17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
17q21.2
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes the type I keratin 9, an intermediate filament chain expressed only in the terminally differentiated epidermis of palms and soles. Mutations in this gene cause epidermolytic palmoplantar keratoderma. [provided by RefSeq, Jul 2008]
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs28940896 G>A,C Pathogenic, not-provided Missense variant, coding sequence variant
rs56707768 T>A,C Pathogenic, not-provided Missense variant, coding sequence variant
rs57019720 C>T Pathogenic, not-provided Missense variant, coding sequence variant
rs57536312 A>T Pathogenic, not-provided Missense variant, coding sequence variant
rs57758262 C>G,T Uncertain-significance, pathogenic, not-provided Missense variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT2027697 hsa-miR-3688-3p CLIP-seq
MIRT2027698 hsa-miR-3978 CLIP-seq
MIRT2259032 hsa-miR-3663-3p CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0002009 Process Morphogenesis of an epithelium IBA
GO:0005198 Function Structural molecule activity IEA
GO:0005200 Function Structural constituent of cytoskeleton TAS 8647270
GO:0005615 Component Extracellular space HDA 22664934, 23580065
GO:0005634 Component Nucleus HDA 21630459
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
607606 6447 ENSG00000171403
Protein
UniProt ID P35527
Protein name Keratin, type I cytoskeletal 9 (Cytokeratin-9) (CK-9) (Keratin-9) (K9)
Protein function May serve an important special function either in the mature palmar and plantar skin tissue or in the morphogenetic program of the formation of these tissues. Plays a role in keratin filament assembly. {ECO:0000269|PubMed:10218578, ECO:0000269|P
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00038 Filament 152 464 Intermediate filament protein Coiled-coil
Tissue specificity TISSUE SPECIFICITY: Expressed in the terminally differentiated epidermis of palms and soles. {ECO:0000269|PubMed:7507869}.
Sequence
MSCRQFSSSYLSRSGGGGGGGLGSGGSIRSSYSRFSSSGGGGGGGRFSSSSGYGGGSSRV
CGRGGGGSFGYSYGGGSGGGFSASSLGGGFGGGSRGFGGASGGGYSSSGGFGGGFGGGSG
GGFGGGYGSGFGGFGGFGGGAGGGDGGILTANEKSTMQELNSRLASYLDKVQALEEANND
LENKIQDWYDKKGPAAIQKNYSPYYNTIDDLKDQIVDLTVGNNKTLLDIDNTRMTLDDFR
IKFEMEQNLRQGVDADINGLRQVLDNLTMEKSDLEMQYETLQEELMALKKNHKEEMSQLT
GQNSGDVNVEINVAPGKDLTKTLNDMRQEYEQLIAKNRKDIENQYETQITQIEHEVSSSG
QEVQSSAKEVTQLRHGVQELEIELQSQLSKKAALEKSLEDTKNRYCGQLQMIQEQISNLE
AQITDVRQEIECQNQEYSLLLSIKMRLEKEIETYHNLLEGGQED
FESSGAGKIGLGGRGG
SGGSYGRGSRGGSGGSYGGGGSGGGYGGGSGSRGGSGGSYGGGSGSGGGSGGGYGGGSGG
GHSGGSGGGHSGGSGGNYGGGSGSGGGSGGGYGGGSGSRGGSGGSHGGGSGFGGESGGSY
GGGEEASGSGGGYGGGSGKSSHS
Sequence length 623
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Estrogen signaling pathway
Staphylococcus aureus infection
  Keratinization
Formation of the cornified envelope
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
palmoplantar keratoderma Palmoplantar keratoderma rs59616921 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Psoriasis Psoriasis N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
AA amyloidosis Associate 32861330
Alzheimer Disease Associate 26973255
Carcinoma Squamous Cell Associate 23702732
Diabetes Mellitus Inhibit 28403359
Epidermolysis Bullosa Associate 19874353, 7528239
Femur Head Necrosis Inhibit 29207081
Hairy palms and soles Associate 7532198
Hyperkeratosis Epidermolytic Associate 10536990, 7523529, 7532198, 9204965
Hyperplasia Associate 23702732
Keratoderma Palmoplantar Associate 10536990, 36076978, 7532199, 9833037