Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	3845
Gene name Gene Name - the full gene name approved by the HGNC.	KRAS proto-oncogene, GTPase
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	KRAS
Synonyms (NCBI Gene) Gene synonyms aliases	'C-K-RAS, C-K-RAS, CFC2, K-RAS2A, K-RAS2B, K-RAS4A, K-RAS4B, K-Ras, K-Ras 2, KI-RAS, KRAS1, KRAS2, NS, NS3, OES, RALD, RASK2, c-Ki-ras, c-Ki-ras2
Chromosome Chromosome number	12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	12p12.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene, a Kirsten ras oncogene homolog from the mammalian ras gene family, encodes a protein that is a member of the small GTPase superfamily. A single amino acid substitution is responsible for an activating mutation. The transforming protein that res

Show/Hide all(46)

SNP ID	Visualize variation	Clinical significance	Consequence
rs17851045	T>A,G	Likely-pathogenic, pathogenic	Missense variant, coding sequence variant
rs104894359	C>G,T	Pathogenic	Coding sequence variant, missense variant
rs104894360	T>A,C	Pathogenic, likely-pathogenic	Missense variant, coding sequence variant, 3 prime UTR variant
rs104894361	T>A,C,G	Pathogenic, uncertain-significance	Coding sequence variant, synonymous variant, missense variant
rs104894362	G>C	Pathogenic	Missense variant, coding sequence variant, 3 prime UTR variant
rs104894364	G>A	Pathogenic	Coding sequence variant, missense variant
rs104894365	C>T	Pathogenic, not-provided	Coding sequence variant, missense variant
rs104894366	G>A,C	Pathogenic, likely-pathogenic	Coding sequence variant, missense variant
rs104894367	A>C	Pathogenic	Missense variant, coding sequence variant, 3 prime UTR variant
rs112445441	C>A,G,T	Drug-response, pathogenic, likely-pathogenic	Coding sequence variant, missense variant
rs121913236	G>C,T	Pathogenic, likely-pathogenic	Coding sequence variant, missense variant
rs121913238	G>C,T	Likely-pathogenic, pathogenic	Coding sequence variant, missense variant
rs121913240	T>A,C,G	Pathogenic, likely-pathogenic	Coding sequence variant, missense variant
rs121913527	C>A,G,T	Pathogenic, likely-pathogenic, uncertain-significance	Coding sequence variant, missense variant
rs121913528	C>A,T	Likely-pathogenic, pathogenic	Coding sequence variant, missense variant
rs121913529	C>A,G,T	Not-provided, pathogenic, likely-pathogenic	Coding sequence variant, missense variant
rs121913530	C>A,G,T	Likely-pathogenic, pathogenic, not-provided, uncertain-significance	Coding sequence variant, missense variant
rs121913535	C>A,G,T	Pathogenic	Coding sequence variant, missense variant
rs121913538	C>A,G	Likely-pathogenic, pathogenic	Coding sequence variant, missense variant
rs193929331	T>C	Pathogenic, likely-pathogenic	Missense variant, coding sequence variant
rs201170656	T>G	Conflicting-interpretations-of-pathogenicity	Intron variant, missense variant, coding sequence variant
rs373169526	A>T	Conflicting-interpretations-of-pathogenicity	Intron variant, coding sequence variant, stop gained
rs387907205	A>C,G	Likely-pathogenic, pathogenic	Missense variant, coding sequence variant
rs387907206	T>C	Pathogenic, pathogenic-likely-pathogenic	Missense variant, coding sequence variant
rs397517040	G>A,T	Likely-pathogenic	Coding sequence variant, synonymous variant
rs397517041	C>A	Likely-pathogenic	Missense variant, 3 prime UTR variant, coding sequence variant
rs397517042	A>C,T	Likely-pathogenic, pathogenic	Missense variant, 3 prime UTR variant, coding sequence variant
rs397517476	A>G,T	Conflicting-interpretations-of-pathogenicity, likely-benign	Intron variant, missense variant, coding sequence variant
rs606231202	->CCA	Pathogenic	Coding sequence variant, inframe insertion
rs727503106	C>T	Likely-pathogenic	Coding sequence variant, missense variant
rs727503108	C>A	Likely-pathogenic, pathogenic	Coding sequence variant, missense variant
rs727503109	T>C	Likely-pathogenic, pathogenic	Coding sequence variant, missense variant
rs727503110	T>A,C	Likely-pathogenic, pathogenic	Coding sequence variant, missense variant
rs727504662	T>A	Pathogenic	Coding sequence variant, missense variant
rs730880469	CTC>-	Likely-pathogenic	Coding sequence variant, inframe deletion
rs730880471	C>T	Likely-pathogenic, not-provided	Coding sequence variant, missense variant
rs730880472	A>C	Likely-pathogenic	Coding sequence variant, missense variant
rs770248150	T>A,G	Pathogenic, likely-pathogenic	Coding sequence variant, missense variant
rs1057519725	G>A	Not-provided, pathogenic	Missense variant, coding sequence variant
rs1064796748	->GCC	Pathogenic	Inframe indel, coding sequence variant
rs1135401776	T>C	Pathogenic	Missense variant, coding sequence variant
rs1555194026	C>A	Likely-pathogenic, uncertain-significance	Missense variant, coding sequence variant
rs1555195579	C>A	Likely-pathogenic	Missense variant, coding sequence variant
rs1565878932	C>T	Pathogenic	3 prime UTR variant, missense variant, coding sequence variant
rs1592798693	T>A	Likely-pathogenic	Missense variant, intron variant, coding sequence variant
rs1592808357	C>A,G	Likely-pathogenic	Missense variant, coding sequence variant

Show/Hide all(884)

miRTarBase ID	miRNA	Experiments	Reference
MIRT000312	hsa-miR-143-3p	qRT-PCR, Luciferase reporter assay, Microarray	19137007
MIRT000312	hsa-miR-143-3p	qRT-PCR, Luciferase reporter assay, Microarray	19137007
MIRT000399	hsa-let-7g-5p	Luciferase reporter assay	18308936
MIRT000312	hsa-miR-143-3p	Luciferase reporter assay	19137007
MIRT000312	hsa-miR-143-3p	Luciferase reporter assay	19137007
MIRT003521	hsa-miR-133b	Review	20144549
MIRT001855	hsa-let-7a-5p	Western blot	20033209
MIRT003210	hsa-miR-181c-5p	Luciferase reporter assay, qRT-PCR, Western blot	20080834
MIRT001855	hsa-let-7a-5p	Luciferase reporter assay, Microarray	15766527
MIRT005100	hsa-miR-155-5p	pSILAC	18668040
MIRT001855	hsa-let-7a-5p	qRT-PCR, Western blot	16651716
MIRT000312	hsa-miR-143-3p	qRT-PCR, Western blot	19157460
MIRT005100	hsa-miR-155-5p	Microarray	19193853
MIRT000230	hsa-miR-18a-3p	Luciferase reporter assay, qRT-PCR, Western blot	19372139
MIRT005553	hsa-miR-96-5p	Immunoblot, Immunohistochemistry, Northern blot, Quantitative proteomic approach, Western blot	20610624
MIRT005553	hsa-miR-96-5p	Immunoblot, Immunohistochemistry, Northern blot, Quantitative proteomic approach, Western blot	20610624
MIRT006144	hsa-miR-216b-5p	Luciferase reporter assay, qRT-PCR, Western blot	21878506
MIRT006144	hsa-miR-216b-5p	Luciferase reporter assay, qRT-PCR, Western blot	21878506
MIRT006450	hsa-miR-126-3p	Immunohistochemistry, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	22384141
MIRT006450	hsa-miR-126-3p	Immunohistochemistry, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	22384141
MIRT006450	hsa-miR-126-3p	Immunohistochemistry, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	22384141
MIRT006450	hsa-miR-126-3p	Immunohistochemistry, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	22384141
MIRT006144	hsa-miR-216b-5p	Luciferase reporter assay, qRT-PCR, Western blot	21878506
MIRT006450	hsa-miR-126-3p	Immunohistochemistry, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	22384141
MIRT006450	hsa-miR-126-3p	Immunohistochemistry, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	22384141
MIRT006450	hsa-miR-126-3p	Immunohistochemistry, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	22384141
MIRT006450	hsa-miR-126-3p	Immunohistochemistry, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	22384141
MIRT006501	hsa-miR-217	Luciferase reporter assay	20675343
MIRT006501	hsa-miR-217	Luciferase reporter assay	20675343
MIRT006144	hsa-miR-216b-5p	Luciferase reporter assay, qRT-PCR, Western blot	21878506
MIRT006450	hsa-miR-126-3p	Immunohistochemistry, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	22384141
MIRT006450	hsa-miR-126-3p	Immunohistochemistry, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	22384141
MIRT006450	hsa-miR-126-3p	Immunohistochemistry, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	22384141
MIRT006450	hsa-miR-126-3p	Immunohistochemistry, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	22384141
MIRT006501	hsa-miR-217	Luciferase reporter assay	20675343
MIRT006220	hsa-miR-622	Luciferase reporter assay	22016468
MIRT006220	hsa-miR-622	Luciferase reporter assay	22016468
MIRT006220	hsa-miR-622	Luciferase reporter assay, Western blot	22016468
MIRT006220	hsa-miR-622	Luciferase reporter assay, Western blot	22016468
MIRT006220	hsa-miR-622	Luciferase reporter assay, Western blot	22016468
MIRT006220	hsa-miR-622	Luciferase reporter assay	22016468
MIRT000312	hsa-miR-143-3p	Western blot	23276710
MIRT000312	hsa-miR-143-3p	Western blot	23276710
MIRT016516	hsa-miR-193b-3p	Microarray	20304954
MIRT005100	hsa-miR-155-5p	Proteomics	18668040
MIRT005100	hsa-miR-155-5p	Reporter assay;Other	20584899
MIRT000312	hsa-miR-143-3p	Other	19157460
MIRT006501	hsa-miR-217	Reporter assay	20675343
MIRT025201	hsa-miR-181a-5p	Sequencing	20371350
MIRT005553	hsa-miR-96-5p	Sequencing	20371350
MIRT005553	hsa-miR-96-5p	Reporter assay;Western blot;qRT-PCR;Other	20610624
MIRT053090	hsa-miR-16-5p	Luciferase reporter assay, Western blot	23507142
MIRT053090	hsa-miR-16-5p	Luciferase reporter assay, Western blot	23507142
MIRT053135	hsa-miR-134-5p	Luciferase reporter assay, qRT-PCR, Western blot	23775631
MIRT053135	hsa-miR-134-5p	Luciferase reporter assay, qRT-PCR, Western blot	23775631
MIRT053135	hsa-miR-134-5p	Luciferase reporter assay, qRT-PCR, Western blot	23775631
MIRT053135	hsa-miR-134-5p	Luciferase reporter assay, qRT-PCR, Western blot	23775631
MIRT053135	hsa-miR-134-5p	Luciferase reporter assay, qRT-PCR, Western blot	23775631
MIRT053135	hsa-miR-134-5p	Luciferase reporter assay, qRT-PCR, Western blot	23775631
MIRT053135	hsa-miR-134-5p	Luciferase reporter assay, qRT-PCR, Western blot	23775631
MIRT053135	hsa-miR-134-5p	Luciferase reporter assay, qRT-PCR, Western blot	23775631
MIRT000312	hsa-miR-143-3p	Luciferase reporter assay, qRT-PCR, Western blot	23128394
MIRT000312	hsa-miR-143-3p	Luciferase reporter assay, qRT-PCR, Western blot	23128394
MIRT053521	hsa-miR-224-5p	qRT-PCR, Western blot	23667495
MIRT053523	hsa-miR-452-5p	qRT-PCR, Western blot	23667495
MIRT053524	hsa-miR-152-3p	qRT-PCR, Western blot	23667495
MIRT053525	hsa-miR-340-5p	qRT-PCR, Western blot	23667495
MIRT003210	hsa-miR-181c-5p	qRT-PCR, Western blot	23667495
MIRT053561	hsa-miR-433-3p	Luciferase reporter assay, qRT-PCR, Western blot	23880861
MIRT053561	hsa-miR-433-3p	Luciferase reporter assay, qRT-PCR, Western blot	23880861
MIRT005553	hsa-miR-96-5p	Luciferase reporter assay, qRT-PCR, Western blot	23752186
MIRT025201	hsa-miR-181a-5p	Luciferase reporter assay, qRT-PCR, Western blot	23752186
MIRT053135	hsa-miR-134-5p	Immunoblot, Luciferase reporter assay, qRT-PCR, Western blot	24440911
MIRT437854	hsa-miR-487b-3p	ChIP-seq, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23426183
MIRT438292	hsa-miR-206	Flow, qRT-PCR	24855559
MIRT438292	hsa-miR-206	Luciferase reporter assay, Western blot, qRT-PCR	25246801
MIRT438292	hsa-miR-206	Luciferase reporter assay, Western blot, qRT-PCR	25246801
MIRT438156	hsa-miR-27a-3p	Luciferase reporter assay	24154848
MIRT438156	hsa-miR-27a-3p	Luciferase reporter assay	24154848
MIRT438156	hsa-miR-27a-3p	Luciferase reporter assay	24154848
MIRT438156	hsa-miR-27a-3p	Luciferase reporter assay	24154848
MIRT438025	hsa-miR-200c-3p	Luciferase reporter assay, Western blot, qRT-PCR	24368337
MIRT016516	hsa-miR-193b-3p	In situ hybridization, RTPCR, Luciferase reporter assay, Microarray, Western blot	24374827
MIRT438022	hsa-miR-365a-3p	In situ hybridization, RTPCR, Luciferase reporter assay, Microarray, Western blot	24374827
MIRT438292	hsa-miR-206	Flow, qRT-PCR	24855559
MIRT438292	hsa-miR-206	Luciferase reporter assay, Western blot, qRT-PCR	25246801
MIRT438292	hsa-miR-206	Luciferase reporter assay, Western blot, qRT-PCR	25246801
MIRT438156	hsa-miR-27a-3p	Luciferase reporter assay	24154848
MIRT438156	hsa-miR-27a-3p	Luciferase reporter assay	24154848
MIRT438156	hsa-miR-27a-3p	Luciferase reporter assay	24154848
MIRT438156	hsa-miR-27a-3p	Luciferase reporter assay	24154848
MIRT438025	hsa-miR-200c-3p	Luciferase reporter assay, Western blot, qRT-PCR	24368337
MIRT016516	hsa-miR-193b-3p	In situ hybridization, RTPCR, Luciferase reporter assay, Microarray, Western blot	24374827
MIRT438022	hsa-miR-365a-3p	In situ hybridization, RTPCR, Luciferase reporter assay, Microarray, Western blot	24374827
MIRT566996	hsa-miR-4698	PAR-CLIP	20371350
MIRT566995	hsa-miR-4328	PAR-CLIP	20371350
MIRT566993	hsa-miR-4666b	PAR-CLIP	20371350
MIRT566994	hsa-let-7c-3p	PAR-CLIP	20371350
MIRT566992	hsa-miR-30a-3p	PAR-CLIP	20371350
MIRT566991	hsa-miR-30d-3p	PAR-CLIP	20371350
MIRT566990	hsa-miR-30e-3p	PAR-CLIP	20371350
MIRT562040	hsa-miR-3606-3p	PAR-CLIP	20371350
MIRT562039	hsa-miR-513a-3p	PAR-CLIP	20371350
MIRT562038	hsa-miR-513c-3p	PAR-CLIP	20371350
MIRT562037	hsa-miR-873-5p	PAR-CLIP	20371350
MIRT562036	hsa-miR-671-5p	PAR-CLIP	20371350
MIRT562035	hsa-miR-124-5p	PAR-CLIP	20371350
MIRT562034	hsa-miR-642b-5p	PAR-CLIP	20371350
MIRT562033	hsa-miR-642a-5p	PAR-CLIP	20371350
MIRT562032	hsa-miR-5010-3p	PAR-CLIP	20371350
MIRT502087	hsa-miR-877-5p	PAR-CLIP	24398324
MIRT502086	hsa-miR-183-5p	PAR-CLIP	24398324
MIRT016516	hsa-miR-193b-3p	PAR-CLIP	24398324
MIRT502085	hsa-miR-193a-3p	PAR-CLIP	24398324
MIRT502084	hsa-miR-200b-3p	PAR-CLIP	24398324
MIRT438025	hsa-miR-200c-3p	PAR-CLIP	24398324
MIRT502083	hsa-miR-429	PAR-CLIP	24398324
MIRT502082	hsa-miR-548ae-3p	PAR-CLIP	24398324
MIRT502081	hsa-miR-548ah-3p	PAR-CLIP	24398324
MIRT502080	hsa-miR-548aj-3p	PAR-CLIP	24398324
MIRT502079	hsa-miR-548am-3p	PAR-CLIP	24398324
MIRT502078	hsa-miR-548aq-3p	PAR-CLIP	24398324
MIRT502077	hsa-miR-548j-3p	PAR-CLIP	24398324
MIRT502076	hsa-miR-548x-3p	PAR-CLIP	24398324
MIRT502075	hsa-miR-5582-3p	PAR-CLIP	24398324
MIRT502074	hsa-miR-514a-5p	PAR-CLIP	24398324
MIRT502073	hsa-miR-892b	PAR-CLIP	24398324
MIRT502072	hsa-miR-3125	PAR-CLIP	24398324
MIRT502071	hsa-miR-3916	PAR-CLIP	24398324
MIRT502070	hsa-miR-6859-5p	PAR-CLIP	24398324
MIRT502069	hsa-miR-326	PAR-CLIP	24398324
MIRT502068	hsa-miR-330-5p	PAR-CLIP	24398324
MIRT502067	hsa-miR-204-3p	PAR-CLIP	24398324
MIRT502066	hsa-miR-4646-5p	PAR-CLIP	24398324
MIRT502065	hsa-miR-3192-5p	PAR-CLIP	24398324
MIRT502064	hsa-miR-619-5p	PAR-CLIP	24398324
MIRT502063	hsa-miR-6506-5p	PAR-CLIP	24398324
MIRT502062	hsa-miR-3148	PAR-CLIP	24398324
MIRT502060	hsa-miR-6716-5p	PAR-CLIP	24398324
MIRT502061	hsa-miR-6866-5p	PAR-CLIP	24398324
MIRT502059	hsa-miR-4314	PAR-CLIP	24398324
MIRT005100	hsa-miR-155-5p	HITS-CLIP	22473208
MIRT005100	hsa-miR-155-5p	HITS-CLIP	22473208
MIRT438156	hsa-miR-27a-3p	qRT-PCR, Luciferase reporter assay, Western blot	25436011
MIRT438156	hsa-miR-27a-3p	qRT-PCR, Luciferase reporter assay, Western blot	25436011
MIRT438156	hsa-miR-27a-3p	qRT-PCR, Luciferase reporter assay, Western blot	25436011
MIRT438292	hsa-miR-206	Luciferase reporter assay, qRT-PCR, Immunohistochemistry, Western blot	25500542
MIRT438292	hsa-miR-206	MiaPaca-2	25500542
MIRT438025	hsa-miR-200c-3p	In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	26392416
MIRT438025	hsa-miR-200c-3p	In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	26392416
MIRT731362	hsa-miR-1-3p	Luciferase reporter assay	26852690
MIRT731362	hsa-miR-1-3p	Luciferase reporter assay	26852690
MIRT731362	hsa-miR-1-3p	Luciferase reporter assay, qRT-PCR, Western blot	26275461
MIRT731362	hsa-miR-1-3p	Luciferase reporter assay, qRT-PCR, Western blot	26275461
MIRT731362	hsa-miR-1-3p	Luciferase reporter assay, qRT-PCR, Western blot	26275461
MIRT731362	hsa-miR-1-3p	Luciferase reporter assay, qRT-PCR, Western blot	26275461
MIRT731411	hsa-miR-199a-5p	qRT-PCR, Western blot	26027911
MIRT731411	hsa-miR-199a-5p	qRT-PCR, Western blot	26027911
MIRT005553	hsa-miR-96-5p	qRT-PCR, Western blot	25256312
MIRT732188	hsa-miR-543	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	26968810
MIRT732188	hsa-miR-543	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	26968810
MIRT732429	hsa-miR-384	Luciferase reporter assay, qRT-PCR, Western blot	27769041
MIRT732429	hsa-miR-384	Luciferase reporter assay, qRT-PCR, Western blot	27769041
MIRT053135	hsa-miR-134-5p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	27830015
MIRT053135	hsa-miR-134-5p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	27830015
MIRT053135	hsa-miR-134-5p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	27830015
MIRT053135	hsa-miR-134-5p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	27830015
MIRT502085	hsa-miR-193a-3p	5.0	27669434
MIRT502085	hsa-miR-193a-3p	5.0	27669434
MIRT502085	hsa-miR-193a-3p	5.0	27669434
MIRT502085	hsa-miR-193a-3p	5.0	27669434
MIRT502085	hsa-miR-193a-3p	5.0	27669434
MIRT502085	hsa-miR-193a-3p	5.0	27669434
MIRT502085	hsa-miR-193a-3p	5.0	27669434
MIRT502085	hsa-miR-193a-3p	5.0	27669434
MIRT502085	hsa-miR-193a-3p	5.0	27669434
MIRT502085	hsa-miR-193a-3p	5.0	27669434
MIRT502085	hsa-miR-193a-3p	5.0	27669434
MIRT502085	hsa-miR-193a-3p	5.0	27669434
MIRT502085	hsa-miR-193a-3p	5.0	27669434
MIRT502085	hsa-miR-193a-3p	5.0	27669434
MIRT502085	hsa-miR-193a-3p	5.0	27669434
MIRT502085	hsa-miR-193a-3p	5.0	27669434
MIRT502085	hsa-miR-193a-3p	6pl, HeyA8, SKOV3.ip1"	27669434
MIRT502085	hsa-miR-193a-3p	5.0	27669434
MIRT502085	hsa-miR-193a-3p	5.0	27669434
MIRT502085	hsa-miR-193a-3p	5.0	27669434
MIRT502085	hsa-miR-193a-3p	5.0	27669434
MIRT502085	hsa-miR-193a-3p	5.0	27669434
MIRT502085	hsa-miR-193a-3p	6pl, HeyA8, SKOV3.ip1"	27669434
MIRT502085	hsa-miR-193a-3p	5.0	27669434
MIRT502085	hsa-miR-193a-3p	5.0	27669434
MIRT502085	hsa-miR-193a-3p	5.0	27669434
MIRT502085	hsa-miR-193a-3p	5.0	27669434
MIRT502085	hsa-miR-193a-3p	5.0	27669434
MIRT502085	hsa-miR-193a-3p	6pl, HeyA8, SKOV3.ip1"	27669434
MIRT502085	hsa-miR-193a-3p	5.0	27669434
MIRT502085	hsa-miR-193a-3p	5.0	27669434
MIRT053135	hsa-miR-134-5p	Luciferase reporter assay, Western blot	27012554
MIRT053135	hsa-miR-134-5p	Luciferase reporter assay, Western blot	27012554
MIRT053135	hsa-miR-134-5p	Luciferase reporter assay, Western blot, RT-PCR,	27012554
MIRT053135	hsa-miR-134-5p	Luciferase reporter assay, Western blot, RT-PCR,	27012554
MIRT053135	hsa-miR-134-5p	Luciferase reporter assay, Western blot, RT-PCR,	27012554
MIRT053135	hsa-miR-134-5p	Luciferase reporter assay, Western blot, RT-PCR,	27012554
MIRT053135	hsa-miR-134-5p	Luciferase reporter assay, Western blot, RT-PCR,	27012554
MIRT053135	hsa-miR-134-5p	Luciferase reporter assay, Western blot, RT-PCR,	27012554
MIRT053135	hsa-miR-134-5p	Luciferase reporter assay, Western blot, RT-PCR,	27012554
MIRT053135	hsa-miR-134-5p	Luciferase reporter assay, Western blot, RT-PCR,	27012554
MIRT053135	hsa-miR-134-5p	Luciferase reporter assay, Western blot, RT-PCR,	27012554
MIRT053135	hsa-miR-134-5p	Luciferase reporter assay, Western blot, RT-PCR,	27012554
MIRT053135	hsa-miR-134-5p	Luciferase reporter assay, Western blot, RT-PCR,	27012554
MIRT053135	hsa-miR-134-5p	Luciferase reporter assay, Western blot, RT-PCR,	27012554
MIRT053135	hsa-miR-134-5p	Luciferase reporter assay, Western blot, RT-PCR,	27012554
MIRT053135	hsa-miR-134-5p	Luciferase reporter assay, Western blot, RT-PCR,	27012554
MIRT025201	hsa-miR-181a-5p	Luciferase reporter assay, qRT-PCR, Western blot	27517749
MIRT025201	hsa-miR-181a-5p	Luciferase reporter assay, qRT-PCR, Western blot	27517749
MIRT025201	hsa-miR-181a-5p	Luciferase reporter assay, qRT-PCR, Western blot	27517749
MIRT025201	hsa-miR-181a-5p	Luciferase reporter assay, qRT-PCR, Western blot	27517749
MIRT016516	hsa-miR-193b-3p	Luciferase reporter assay, Western blot	25905463
MIRT016516	hsa-miR-193b-3p	Luciferase reporter assay, Western blot	25905463
MIRT016516	hsa-miR-193b-3p	Luciferase reporter assay, Western blot	25905463
MIRT016516	hsa-miR-193b-3p	Luciferase reporter assay, Western blot	25905463
MIRT001855	hsa-let-7a-5p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	25955298
MIRT005553	hsa-miR-96-5p	Immunofluorescence, Luciferase reporter assay, qRT-PCR, Western blotting	33973871
MIRT732808	hsa-miR-455-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blotting	33505218
MIRT733424	hsa-miR-1184	Immunohistochemistry (IHC), Immunoprecipitaion (IP), Luciferase reporter assay, qRT-PCR	34234808
MIRT734175	hsa-miR-210-3p	Immunofluorescence, qRT-PCR, Western blotting	31927946
MIRT734177	hsa-miR-636	Luciferase reporter assay, Western blotting	33192092
MIRT000312	hsa-miR-143-3p	Microarray	33825830
MIRT734573	hsa-miR-145-3p	Microarray	33825830
MIRT734573	hsa-miR-145-3p	qRT-PCR	33250681
MIRT003210	hsa-miR-181c-5p	Western blotting, Microarray, qRT-PCR	31441360
MIRT735861	hsa-miR-27b-3p	qRT-PCR	32676506
MIRT735862	miR-let7d-5p	qRT-PCR	32676506
MIRT735863	hsa-miR-149-5p	qRT-PCR	32676506
MIRT735864	hsa-miR-150-5p	qRT-PCR	32676506
MIRT735865	hsa-miR-9-5p	qRT-PCR	32676506
MIRT735866	hsa-miR-215-5p	qRT-PCR	32676506
MIRT735867	hsa-miR-15b-5p	qRT-PCR	32676506
MIRT735868	hsa-miR-10a-5p	qRT-PCR	32676506
MIRT735869	hsa-miR-135b-5p	qRT-PCR	32676506
MIRT735870	hsa-miR-191-5p	qRT-PCR	32676506
MIRT735871	hsa-miR-138-5p	qRT-PCR	32676506
MIRT735874	hsa-miR-139-5p	Luciferase reporter assay, Western blotting, Microarray, Immunohistochemistry (IHC), Immunofluorescence, ChIP-seq, qRT-PCR, in vivo gain/loss-of-function experiments	32641995
MIRT735874	hsa-miR-139-5p	Luciferase reporter assay, Western blotting, Microarray, Immunohistochemistry (IHC), Immunofluorescence, ChIP-seq, qRT-PCR, In situ hybridization	32641995
MIRT001855	hsa-let-7a-5p	Microarray, qRT-PCR	32651898
MIRT438156	hsa-miR-27a-3p	Western blotting	31717759
MIRT737080	hsa-miR-125b-5p	Microarray, qRT-PCR	31497299
MIRT566996	hsa-miR-4698	PAR-CLIP	20371350
MIRT566995	hsa-miR-4328	PAR-CLIP	20371350
MIRT566993	hsa-miR-4666b	PAR-CLIP	20371350
MIRT566994	hsa-let-7c-3p	PAR-CLIP	20371350
MIRT566992	hsa-miR-30a-3p	PAR-CLIP	20371350
MIRT566991	hsa-miR-30d-3p	PAR-CLIP	20371350
MIRT566990	hsa-miR-30e-3p	PAR-CLIP	20371350
MIRT562040	hsa-miR-3606-3p	PAR-CLIP	20371350
MIRT562039	hsa-miR-513a-3p	PAR-CLIP	20371350
MIRT562038	hsa-miR-513c-3p	PAR-CLIP	20371350
MIRT562037	hsa-miR-873-5p	PAR-CLIP	20371350
MIRT562036	hsa-miR-671-5p	PAR-CLIP	20371350
MIRT562035	hsa-miR-124-5p	PAR-CLIP	20371350
MIRT562034	hsa-miR-642b-5p	PAR-CLIP	20371350
MIRT562033	hsa-miR-642a-5p	PAR-CLIP	20371350
MIRT562032	hsa-miR-5010-3p	PAR-CLIP	20371350
MIRT502087	hsa-miR-877-5p	PAR-CLIP	24398324
MIRT502086	hsa-miR-183-5p	PAR-CLIP	24398324
MIRT016516	hsa-miR-193b-3p	PAR-CLIP	24398324
MIRT502085	hsa-miR-193a-3p	PAR-CLIP	24398324
MIRT502084	hsa-miR-200b-3p	PAR-CLIP	24398324
MIRT438025	hsa-miR-200c-3p	PAR-CLIP	24398324
MIRT502083	hsa-miR-429	PAR-CLIP	24398324
MIRT502082	hsa-miR-548ae-3p	PAR-CLIP	24398324
MIRT502081	hsa-miR-548ah-3p	PAR-CLIP	24398324
MIRT502080	hsa-miR-548aj-3p	PAR-CLIP	24398324
MIRT502079	hsa-miR-548am-3p	PAR-CLIP	24398324
MIRT502078	hsa-miR-548aq-3p	PAR-CLIP	24398324
MIRT502077	hsa-miR-548j-3p	PAR-CLIP	24398324
MIRT502076	hsa-miR-548x-3p	PAR-CLIP	24398324
MIRT502075	hsa-miR-5582-3p	PAR-CLIP	24398324
MIRT502074	hsa-miR-514a-5p	PAR-CLIP	24398324
MIRT502073	hsa-miR-892b	PAR-CLIP	24398324
MIRT502072	hsa-miR-3125	PAR-CLIP	24398324
MIRT502071	hsa-miR-3916	PAR-CLIP	24398324
MIRT502070	hsa-miR-6859-5p	PAR-CLIP	24398324
MIRT502069	hsa-miR-326	PAR-CLIP	24398324
MIRT502068	hsa-miR-330-5p	PAR-CLIP	24398324
MIRT502067	hsa-miR-204-3p	PAR-CLIP	24398324
MIRT502066	hsa-miR-4646-5p	PAR-CLIP	24398324
MIRT502065	hsa-miR-3192-5p	PAR-CLIP	24398324
MIRT502064	hsa-miR-619-5p	PAR-CLIP	24398324
MIRT502063	hsa-miR-6506-5p	PAR-CLIP	24398324
MIRT502062	hsa-miR-3148	PAR-CLIP	24398324
MIRT502060	hsa-miR-6716-5p	PAR-CLIP	24398324
MIRT502061	hsa-miR-6866-5p	PAR-CLIP	24398324
MIRT502059	hsa-miR-4314	PAR-CLIP	24398324
MIRT755565	hsa-miR-532-3p	Western blotting	36324898
MIRT755927	hsa-miR-142-3p	Western blotting, qRT-PCR, in vitro cullelar assays	35194440
MIRT755999	hsa-miR-557	Luciferase reporter assay, Western blotting, qRT-PCR	35087570
MIRT1100513	hsa-miR-1208	CLIP-seq
MIRT1100514	hsa-miR-1256	CLIP-seq
MIRT1100515	hsa-miR-1262	CLIP-seq
MIRT1100516	hsa-miR-1283	CLIP-seq
MIRT1100517	hsa-miR-1323	CLIP-seq
MIRT1100518	hsa-miR-1470	CLIP-seq
MIRT1100519	hsa-miR-181a	CLIP-seq
MIRT1100520	hsa-miR-181b	CLIP-seq
MIRT1100521	hsa-miR-181c	CLIP-seq
MIRT1100522	hsa-miR-181d	CLIP-seq
MIRT1100523	hsa-miR-188-5p	CLIP-seq
MIRT1100524	hsa-miR-193b	CLIP-seq
MIRT1100525	hsa-miR-200b	CLIP-seq
MIRT1100526	hsa-miR-200c	CLIP-seq
MIRT1100527	hsa-miR-204	CLIP-seq
MIRT1100528	hsa-miR-211	CLIP-seq
MIRT1100529	hsa-miR-2114	CLIP-seq
MIRT1100530	hsa-miR-216b	CLIP-seq
MIRT1100531	hsa-miR-23a	CLIP-seq
MIRT1100532	hsa-miR-23b	CLIP-seq
MIRT1100533	hsa-miR-23c	CLIP-seq
MIRT1100534	hsa-miR-30a	CLIP-seq
MIRT1100535	hsa-miR-30b	CLIP-seq
MIRT1100536	hsa-miR-30c	CLIP-seq
MIRT1100537	hsa-miR-30d	CLIP-seq
MIRT1100538	hsa-miR-30e	CLIP-seq
MIRT1100539	hsa-miR-3157-3p	CLIP-seq
MIRT1100540	hsa-miR-3185	CLIP-seq
MIRT1100541	hsa-miR-3192	CLIP-seq
MIRT1100542	hsa-miR-323-3p	CLIP-seq
MIRT1100543	hsa-miR-335	CLIP-seq
MIRT1100544	hsa-miR-34b	CLIP-seq
MIRT1100545	hsa-miR-3613-3p	CLIP-seq
MIRT1100546	hsa-miR-3614-5p	CLIP-seq
MIRT1100547	hsa-miR-3622a-5p	CLIP-seq
MIRT1100548	hsa-miR-362-5p	CLIP-seq
MIRT1100549	hsa-miR-3653	CLIP-seq
MIRT1100550	hsa-miR-3658	CLIP-seq
MIRT1100551	hsa-miR-3660	CLIP-seq
MIRT1100552	hsa-miR-3664-3p	CLIP-seq
MIRT1100553	hsa-miR-3675-3p	CLIP-seq
MIRT1100554	hsa-miR-3688-3p	CLIP-seq
MIRT1100555	hsa-miR-3713	CLIP-seq
MIRT1100556	hsa-miR-380	CLIP-seq
MIRT1100557	hsa-miR-3924	CLIP-seq
MIRT1100558	hsa-miR-3942-3p	CLIP-seq
MIRT1100559	hsa-miR-3973	CLIP-seq
MIRT1100560	hsa-miR-4252	CLIP-seq
MIRT1100561	hsa-miR-4262	CLIP-seq
MIRT1100562	hsa-miR-4433	CLIP-seq
MIRT1100563	hsa-miR-4495	CLIP-seq
MIRT1100564	hsa-miR-4504	CLIP-seq
MIRT1100565	hsa-miR-452	CLIP-seq
MIRT1100566	hsa-miR-4522	CLIP-seq
MIRT1100567	hsa-miR-4526	CLIP-seq
MIRT1100568	hsa-miR-4667-3p	CLIP-seq
MIRT1100569	hsa-miR-4668-3p	CLIP-seq
MIRT1100570	hsa-miR-4676-3p	CLIP-seq
MIRT1100571	hsa-miR-4684-5p	CLIP-seq
MIRT1100572	hsa-miR-4694-3p	CLIP-seq
MIRT1100573	hsa-miR-4695-5p	CLIP-seq
MIRT1100574	hsa-miR-4701-3p	CLIP-seq
MIRT1100575	hsa-miR-4709-3p	CLIP-seq
MIRT1100576	hsa-miR-4714-5p	CLIP-seq
MIRT1100577	hsa-miR-4761-5p	CLIP-seq
MIRT1100578	hsa-miR-4762-5p	CLIP-seq
MIRT1100579	hsa-miR-500b	CLIP-seq
MIRT1100580	hsa-miR-501-5p	CLIP-seq
MIRT1100581	hsa-miR-510	CLIP-seq
MIRT1100582	hsa-miR-512-5p	CLIP-seq
MIRT1100583	hsa-miR-514	CLIP-seq
MIRT1100584	hsa-miR-514b-3p	CLIP-seq
MIRT1100585	hsa-miR-520g	CLIP-seq
MIRT1100586	hsa-miR-520h	CLIP-seq
MIRT1100587	hsa-miR-522	CLIP-seq
MIRT1100588	hsa-miR-548aa	CLIP-seq
MIRT1100589	hsa-miR-548ac	CLIP-seq
MIRT1100590	hsa-miR-548ag	CLIP-seq
MIRT1100591	hsa-miR-548ai	CLIP-seq
MIRT1100592	hsa-miR-548d-3p	CLIP-seq
MIRT1100593	hsa-miR-548m	CLIP-seq
MIRT1100594	hsa-miR-548o	CLIP-seq
MIRT1100595	hsa-miR-548z	CLIP-seq
MIRT1100596	hsa-miR-554	CLIP-seq
MIRT1100597	hsa-miR-584	CLIP-seq
MIRT1100598	hsa-miR-595	CLIP-seq
MIRT1100599	hsa-miR-605	CLIP-seq
MIRT1100600	hsa-miR-661	CLIP-seq
MIRT1100601	hsa-miR-877	CLIP-seq
MIRT1100602	hsa-miR-105	CLIP-seq
MIRT1100603	hsa-miR-1271	CLIP-seq
MIRT1100604	hsa-miR-1273f	CLIP-seq
MIRT1100605	hsa-miR-1278	CLIP-seq
MIRT1100606	hsa-miR-1305	CLIP-seq
MIRT1100607	hsa-miR-143	CLIP-seq
MIRT1100608	hsa-miR-19a	CLIP-seq
MIRT1100609	hsa-miR-19b	CLIP-seq
MIRT1100610	hsa-miR-2053	CLIP-seq
MIRT1100611	hsa-miR-3143	CLIP-seq
MIRT1100612	hsa-miR-3163	CLIP-seq
MIRT1100613	hsa-miR-3189-5p	CLIP-seq
MIRT1100542	hsa-miR-323-3p	CLIP-seq
MIRT1100614	hsa-miR-340	CLIP-seq
MIRT1100615	hsa-miR-3651	CLIP-seq
MIRT1100549	hsa-miR-3653	CLIP-seq
MIRT1100550	hsa-miR-3658	CLIP-seq
MIRT1100616	hsa-miR-3923	CLIP-seq
MIRT1100617	hsa-miR-4275	CLIP-seq
MIRT1100618	hsa-miR-4282	CLIP-seq
MIRT1100563	hsa-miR-4495	CLIP-seq
MIRT1100569	hsa-miR-4668-3p	CLIP-seq
MIRT1100619	hsa-miR-4708-5p	CLIP-seq
MIRT1100620	hsa-miR-4731-3p	CLIP-seq
MIRT1100621	hsa-miR-4758-3p	CLIP-seq
MIRT1100622	hsa-miR-4770	CLIP-seq
MIRT1100623	hsa-miR-4795-3p	CLIP-seq
MIRT1100624	hsa-miR-4801	CLIP-seq
MIRT1100625	hsa-miR-548c-3p	CLIP-seq
MIRT1100626	hsa-miR-548g	CLIP-seq
MIRT1100627	hsa-miR-561	CLIP-seq
MIRT1100628	hsa-miR-628-3p	CLIP-seq
MIRT1100629	hsa-miR-888	CLIP-seq
MIRT1100630	hsa-miR-944	CLIP-seq
MIRT1100631	hsa-miR-96	CLIP-seq
MIRT1100517	hsa-miR-1323	CLIP-seq
MIRT1100524	hsa-miR-193b	CLIP-seq
MIRT1100525	hsa-miR-200b	CLIP-seq
MIRT1100526	hsa-miR-200c	CLIP-seq
MIRT1100541	hsa-miR-3192	CLIP-seq
MIRT1550624	hsa-miR-338-5p	CLIP-seq
MIRT1100594	hsa-miR-548o	CLIP-seq
MIRT1100601	hsa-miR-877	CLIP-seq
MIRT2027371	hsa-miR-154	CLIP-seq
MIRT2027372	hsa-miR-194	CLIP-seq
MIRT2027373	hsa-miR-2110	CLIP-seq
MIRT2027374	hsa-miR-3150a-3p	CLIP-seq
MIRT2027375	hsa-miR-337-3p	CLIP-seq
MIRT1100556	hsa-miR-380	CLIP-seq
MIRT2027376	hsa-miR-4260	CLIP-seq
MIRT2027377	hsa-miR-4270	CLIP-seq
MIRT1100618	hsa-miR-4282	CLIP-seq
MIRT2027378	hsa-miR-4426	CLIP-seq
MIRT1100562	hsa-miR-4433	CLIP-seq
MIRT2027379	hsa-miR-4436b-5p	CLIP-seq
MIRT2027380	hsa-miR-4441	CLIP-seq
MIRT1100563	hsa-miR-4495	CLIP-seq
MIRT2027381	hsa-miR-4647	CLIP-seq
MIRT2027382	hsa-miR-4662b	CLIP-seq
MIRT2027383	hsa-miR-4699-5p	CLIP-seq
MIRT2027384	hsa-miR-4712-3p	CLIP-seq
MIRT2027385	hsa-miR-4803	CLIP-seq
MIRT2027386	hsa-miR-548ae	CLIP-seq
MIRT2027387	hsa-miR-548aj	CLIP-seq
MIRT2027388	hsa-miR-548am	CLIP-seq
MIRT1100625	hsa-miR-548c-3p	CLIP-seq
MIRT2027389	hsa-miR-548n	CLIP-seq
MIRT2027390	hsa-miR-548x	CLIP-seq
MIRT2027391	hsa-miR-580	CLIP-seq
MIRT2027392	hsa-miR-593	CLIP-seq
MIRT2027393	hsa-miR-616	CLIP-seq
MIRT2027394	hsa-miR-642b	CLIP-seq
MIRT2027395	hsa-miR-654-3p	CLIP-seq
MIRT2027396	hsa-miR-1912	CLIP-seq
MIRT2027397	hsa-miR-4534	CLIP-seq
MIRT2027398	hsa-miR-4775	CLIP-seq
MIRT1100589	hsa-miR-548ac	CLIP-seq
MIRT1100592	hsa-miR-548d-3p	CLIP-seq
MIRT2027389	hsa-miR-548n	CLIP-seq
MIRT1100595	hsa-miR-548z	CLIP-seq
MIRT1100602	hsa-miR-105	CLIP-seq
MIRT2258623	hsa-miR-1205	CLIP-seq
MIRT2258624	hsa-miR-1233	CLIP-seq
MIRT2258625	hsa-miR-1236	CLIP-seq
MIRT2258626	hsa-miR-1243	CLIP-seq
MIRT2258627	hsa-miR-1245	CLIP-seq
MIRT2258628	hsa-miR-1246	CLIP-seq
MIRT2258629	hsa-miR-1248	CLIP-seq
MIRT2258630	hsa-miR-125a-5p	CLIP-seq
MIRT2258631	hsa-miR-125b	CLIP-seq
MIRT1100515	hsa-miR-1262	CLIP-seq
MIRT2258632	hsa-miR-1264	CLIP-seq
MIRT1100603	hsa-miR-1271	CLIP-seq
MIRT1100604	hsa-miR-1273f	CLIP-seq
MIRT2258633	hsa-miR-1286	CLIP-seq
MIRT2258634	hsa-miR-1292	CLIP-seq
MIRT2258635	hsa-miR-132	CLIP-seq
MIRT2258636	hsa-miR-134	CLIP-seq
MIRT2258637	hsa-miR-140-3p	CLIP-seq
MIRT1100607	hsa-miR-143	CLIP-seq
MIRT2027371	hsa-miR-154	CLIP-seq
MIRT2258638	hsa-miR-155	CLIP-seq
MIRT1100519	hsa-miR-181a	CLIP-seq
MIRT1100520	hsa-miR-181b	CLIP-seq
MIRT1100521	hsa-miR-181c	CLIP-seq
MIRT1100522	hsa-miR-181d	CLIP-seq
MIRT2258639	hsa-miR-1825	CLIP-seq
MIRT2027372	hsa-miR-194	CLIP-seq
MIRT2258640	hsa-miR-199b-5p	CLIP-seq
MIRT1100610	hsa-miR-2053	CLIP-seq
MIRT2027373	hsa-miR-2110	CLIP-seq
MIRT2258641	hsa-miR-212	CLIP-seq
MIRT2258642	hsa-miR-214	CLIP-seq
MIRT2258643	hsa-miR-216a	CLIP-seq
MIRT2258644	hsa-miR-218	CLIP-seq
MIRT2258645	hsa-miR-224	CLIP-seq
MIRT2258646	hsa-miR-298	CLIP-seq
MIRT1100534	hsa-miR-30a	CLIP-seq
MIRT1100535	hsa-miR-30b	CLIP-seq
MIRT1100536	hsa-miR-30c	CLIP-seq
MIRT1100537	hsa-miR-30d	CLIP-seq
MIRT1100538	hsa-miR-30e	CLIP-seq
MIRT2258647	hsa-miR-3117-5p	CLIP-seq
MIRT2258648	hsa-miR-3118	CLIP-seq
MIRT2258649	hsa-miR-3134	CLIP-seq
MIRT2027374	hsa-miR-3150a-3p	CLIP-seq
MIRT2258650	hsa-miR-3157-5p	CLIP-seq
MIRT2258651	hsa-miR-3158-5p	CLIP-seq
MIRT2258652	hsa-miR-3160-3p	CLIP-seq
MIRT2258653	hsa-miR-3164	CLIP-seq
MIRT1100540	hsa-miR-3185	CLIP-seq
MIRT1100541	hsa-miR-3192	CLIP-seq
MIRT1100542	hsa-miR-323-3p	CLIP-seq
MIRT2258654	hsa-miR-331-5p	CLIP-seq
MIRT1100543	hsa-miR-335	CLIP-seq
MIRT2027375	hsa-miR-337-3p	CLIP-seq
MIRT1550624	hsa-miR-338-5p	CLIP-seq
MIRT2258655	hsa-miR-3606	CLIP-seq
MIRT1100545	hsa-miR-3613-3p	CLIP-seq
MIRT2258656	hsa-miR-3619-5p	CLIP-seq
MIRT2258657	hsa-miR-3622a-3p	CLIP-seq
MIRT1100547	hsa-miR-3622a-5p	CLIP-seq
MIRT2258658	hsa-miR-3622b-3p	CLIP-seq
MIRT2258659	hsa-miR-3647-3p	CLIP-seq
MIRT2258660	hsa-miR-365	CLIP-seq
MIRT1100549	hsa-miR-3653	CLIP-seq
MIRT1100550	hsa-miR-3658	CLIP-seq
MIRT1100552	hsa-miR-3664-3p	CLIP-seq
MIRT2258661	hsa-miR-3675-5p	CLIP-seq
MIRT2258662	hsa-miR-3679-3p	CLIP-seq
MIRT1100554	hsa-miR-3688-3p	CLIP-seq
MIRT2258663	hsa-miR-3689d	CLIP-seq
MIRT2258664	hsa-miR-3692	CLIP-seq
MIRT1100556	hsa-miR-380	CLIP-seq
MIRT2258665	hsa-miR-3915	CLIP-seq
MIRT2258666	hsa-miR-3928	CLIP-seq
MIRT2258667	hsa-miR-3978	CLIP-seq
MIRT2258668	hsa-miR-421	CLIP-seq
MIRT1100560	hsa-miR-4252	CLIP-seq
MIRT2258669	hsa-miR-4253	CLIP-seq
MIRT2027376	hsa-miR-4260	CLIP-seq
MIRT1100561	hsa-miR-4262	CLIP-seq
MIRT2258670	hsa-miR-4269	CLIP-seq
MIRT2027377	hsa-miR-4270	CLIP-seq
MIRT2258671	hsa-miR-4274	CLIP-seq
MIRT1100618	hsa-miR-4282	CLIP-seq
MIRT2258672	hsa-miR-4291	CLIP-seq
MIRT2258673	hsa-miR-4311	CLIP-seq
MIRT2258674	hsa-miR-4312	CLIP-seq
MIRT2258675	hsa-miR-4317	CLIP-seq
MIRT2258676	hsa-miR-4319	CLIP-seq
MIRT2258677	hsa-miR-4422	CLIP-seq
MIRT2258678	hsa-miR-4423-3p	CLIP-seq
MIRT2027378	hsa-miR-4426	CLIP-seq
MIRT2258679	hsa-miR-4428	CLIP-seq
MIRT1100562	hsa-miR-4433	CLIP-seq
MIRT2027379	hsa-miR-4436b-5p	CLIP-seq
MIRT2027380	hsa-miR-4441	CLIP-seq
MIRT2258680	hsa-miR-4446-5p	CLIP-seq
MIRT2258681	hsa-miR-4450	CLIP-seq
MIRT2258682	hsa-miR-4471	CLIP-seq
MIRT2258683	hsa-miR-4477b	CLIP-seq
MIRT2258684	hsa-miR-4487	CLIP-seq
MIRT2258685	hsa-miR-4490	CLIP-seq
MIRT2258686	hsa-miR-4491	CLIP-seq
MIRT1100563	hsa-miR-4495	CLIP-seq
MIRT1100564	hsa-miR-4504	CLIP-seq
MIRT2258687	hsa-miR-4514	CLIP-seq
MIRT2258688	hsa-miR-4517	CLIP-seq
MIRT2258689	hsa-miR-4519	CLIP-seq
MIRT2258690	hsa-miR-4521	CLIP-seq
MIRT2027397	hsa-miR-4534	CLIP-seq
MIRT2258691	hsa-miR-4641	CLIP-seq
MIRT2027381	hsa-miR-4647	CLIP-seq
MIRT2258692	hsa-miR-4657	CLIP-seq
MIRT2027382	hsa-miR-4662b	CLIP-seq
MIRT2258693	hsa-miR-4663	CLIP-seq
MIRT2258694	hsa-miR-4666-3p	CLIP-seq
MIRT2258695	hsa-miR-4686	CLIP-seq
MIRT2258696	hsa-miR-4691-3p	CLIP-seq
MIRT2258697	hsa-miR-4692	CLIP-seq
MIRT1100573	hsa-miR-4695-5p	CLIP-seq
MIRT2027383	hsa-miR-4699-5p	CLIP-seq
MIRT1100574	hsa-miR-4701-3p	CLIP-seq
MIRT2258698	hsa-miR-4704-5p	CLIP-seq
MIRT1100619	hsa-miR-4708-5p	CLIP-seq
MIRT2258699	hsa-miR-4711-5p	CLIP-seq
MIRT2027384	hsa-miR-4712-3p	CLIP-seq
MIRT2258700	hsa-miR-4729	CLIP-seq
MIRT2258701	hsa-miR-4742-5p	CLIP-seq
MIRT2258702	hsa-miR-4760-3p	CLIP-seq
MIRT1100578	hsa-miR-4762-5p	CLIP-seq
MIRT2258703	hsa-miR-4768-5p	CLIP-seq
MIRT1100622	hsa-miR-4770	CLIP-seq
MIRT2258704	hsa-miR-4774-5p	CLIP-seq
MIRT2027398	hsa-miR-4775	CLIP-seq
MIRT2258705	hsa-miR-4778-3p	CLIP-seq
MIRT2258706	hsa-miR-4797-5p	CLIP-seq
MIRT2258707	hsa-miR-4802-5p	CLIP-seq
MIRT2027385	hsa-miR-4803	CLIP-seq
MIRT2258708	hsa-miR-486-3p	CLIP-seq
MIRT2258709	hsa-miR-491-5p	CLIP-seq
MIRT2258710	hsa-miR-499-3p	CLIP-seq
MIRT2258711	hsa-miR-499a-3p	CLIP-seq
MIRT2258712	hsa-miR-5096	CLIP-seq
MIRT1100581	hsa-miR-510	CLIP-seq
MIRT1100582	hsa-miR-512-5p	CLIP-seq
MIRT2258713	hsa-miR-513b	CLIP-seq
MIRT2258714	hsa-miR-513c	CLIP-seq
MIRT2258715	hsa-miR-514b-5p	CLIP-seq
MIRT2258716	hsa-miR-544b	CLIP-seq
MIRT2258717	hsa-miR-545	CLIP-seq
MIRT2258718	hsa-miR-548a-3p	CLIP-seq
MIRT1100589	hsa-miR-548ac	CLIP-seq
MIRT2027386	hsa-miR-548ae	CLIP-seq
MIRT1100590	hsa-miR-548ag	CLIP-seq
MIRT1100591	hsa-miR-548ai	CLIP-seq
MIRT2027387	hsa-miR-548aj	CLIP-seq
MIRT2027388	hsa-miR-548am	CLIP-seq
MIRT1100625	hsa-miR-548c-3p	CLIP-seq
MIRT1100592	hsa-miR-548d-3p	CLIP-seq
MIRT2258719	hsa-miR-548e	CLIP-seq
MIRT2258720	hsa-miR-548f	CLIP-seq
MIRT2258721	hsa-miR-548l	CLIP-seq
MIRT2027389	hsa-miR-548n	CLIP-seq
MIRT2027390	hsa-miR-548x	CLIP-seq
MIRT1100595	hsa-miR-548z	CLIP-seq
MIRT2258722	hsa-miR-549	CLIP-seq
MIRT1100596	hsa-miR-554	CLIP-seq
MIRT2258723	hsa-miR-558	CLIP-seq
MIRT2258724	hsa-miR-566	CLIP-seq
MIRT2258725	hsa-miR-569	CLIP-seq
MIRT2258726	hsa-miR-570	CLIP-seq
MIRT2027391	hsa-miR-580	CLIP-seq
MIRT1100597	hsa-miR-584	CLIP-seq
MIRT2258727	hsa-miR-587	CLIP-seq
MIRT2027392	hsa-miR-593	CLIP-seq
MIRT1100599	hsa-miR-605	CLIP-seq
MIRT2027393	hsa-miR-616	CLIP-seq
MIRT2027394	hsa-miR-642b	CLIP-seq
MIRT2258728	hsa-miR-652	CLIP-seq
MIRT2027395	hsa-miR-654-3p	CLIP-seq
MIRT1100600	hsa-miR-661	CLIP-seq
MIRT2258729	hsa-miR-7	CLIP-seq
MIRT2258730	hsa-miR-759	CLIP-seq
MIRT1100601	hsa-miR-877	CLIP-seq
MIRT1100629	hsa-miR-888	CLIP-seq
MIRT2258731	hsa-miR-921	CLIP-seq
MIRT2258732	hsa-miR-922	CLIP-seq
MIRT1100631	hsa-miR-96	CLIP-seq
MIRT1100515	hsa-miR-1262	CLIP-seq
MIRT2027371	hsa-miR-154	CLIP-seq
MIRT2027372	hsa-miR-194	CLIP-seq
MIRT2027373	hsa-miR-2110	CLIP-seq
MIRT2258644	hsa-miR-218	CLIP-seq
MIRT2027374	hsa-miR-3150a-3p	CLIP-seq
MIRT2390024	hsa-miR-3175	CLIP-seq
MIRT1100541	hsa-miR-3192	CLIP-seq
MIRT2027375	hsa-miR-337-3p	CLIP-seq
MIRT1100544	hsa-miR-34b	CLIP-seq
MIRT1100546	hsa-miR-3614-5p	CLIP-seq
MIRT1100547	hsa-miR-3622a-5p	CLIP-seq
MIRT2258668	hsa-miR-421	CLIP-seq
MIRT2027376	hsa-miR-4260	CLIP-seq
MIRT2027377	hsa-miR-4270	CLIP-seq
MIRT1100618	hsa-miR-4282	CLIP-seq
MIRT2258674	hsa-miR-4312	CLIP-seq
MIRT2027378	hsa-miR-4426	CLIP-seq
MIRT1100562	hsa-miR-4433	CLIP-seq
MIRT2027380	hsa-miR-4441	CLIP-seq
MIRT2027381	hsa-miR-4647	CLIP-seq
MIRT2027382	hsa-miR-4662b	CLIP-seq
MIRT2258693	hsa-miR-4663	CLIP-seq
MIRT1100574	hsa-miR-4701-3p	CLIP-seq
MIRT2027384	hsa-miR-4712-3p	CLIP-seq
MIRT1100577	hsa-miR-4761-5p	CLIP-seq
MIRT2027385	hsa-miR-4803	CLIP-seq
MIRT1100625	hsa-miR-548c-3p	CLIP-seq
MIRT2258727	hsa-miR-587	CLIP-seq
MIRT2027394	hsa-miR-642b	CLIP-seq
MIRT1100620	hsa-miR-4731-3p	CLIP-seq
MIRT1100624	hsa-miR-4801	CLIP-seq
MIRT2258726	hsa-miR-570	CLIP-seq
MIRT2559422	hsa-miR-101	CLIP-seq
MIRT2559423	hsa-miR-1197	CLIP-seq
MIRT1100515	hsa-miR-1262	CLIP-seq
MIRT2258635	hsa-miR-132	CLIP-seq
MIRT2559424	hsa-miR-1322	CLIP-seq
MIRT2559425	hsa-miR-142-5p	CLIP-seq
MIRT2559426	hsa-miR-144	CLIP-seq
MIRT2027371	hsa-miR-154	CLIP-seq
MIRT2258639	hsa-miR-1825	CLIP-seq
MIRT2559427	hsa-miR-185	CLIP-seq
MIRT2559428	hsa-miR-186	CLIP-seq
MIRT2027372	hsa-miR-194	CLIP-seq
MIRT2258640	hsa-miR-199b-5p	CLIP-seq
MIRT2258641	hsa-miR-212	CLIP-seq
MIRT2258644	hsa-miR-218	CLIP-seq
MIRT2559429	hsa-miR-2276	CLIP-seq
MIRT2559430	hsa-miR-2355-3p	CLIP-seq
MIRT2258647	hsa-miR-3117-5p	CLIP-seq
MIRT2559431	hsa-miR-3135	CLIP-seq
MIRT2559432	hsa-miR-3151	CLIP-seq
MIRT2390024	hsa-miR-3175	CLIP-seq
MIRT2559433	hsa-miR-3177-5p	CLIP-seq
MIRT1100540	hsa-miR-3185	CLIP-seq
MIRT2559434	hsa-miR-3201	CLIP-seq
MIRT1100544	hsa-miR-34b	CLIP-seq
MIRT1100545	hsa-miR-3613-3p	CLIP-seq
MIRT1100546	hsa-miR-3614-5p	CLIP-seq
MIRT1100547	hsa-miR-3622a-5p	CLIP-seq
MIRT1100548	hsa-miR-362-5p	CLIP-seq
MIRT2559435	hsa-miR-3646	CLIP-seq
MIRT1100554	hsa-miR-3688-3p	CLIP-seq
MIRT2559436	hsa-miR-369-5p	CLIP-seq
MIRT1100555	hsa-miR-3713	CLIP-seq
MIRT2559437	hsa-miR-3976	CLIP-seq
MIRT2559438	hsa-miR-4276	CLIP-seq
MIRT1100618	hsa-miR-4282	CLIP-seq
MIRT2559439	hsa-miR-4306	CLIP-seq
MIRT2559440	hsa-miR-433	CLIP-seq
MIRT2258678	hsa-miR-4423-3p	CLIP-seq
MIRT2027378	hsa-miR-4426	CLIP-seq
MIRT2559441	hsa-miR-4427	CLIP-seq
MIRT2559442	hsa-miR-4447	CLIP-seq
MIRT2559443	hsa-miR-4453	CLIP-seq
MIRT2559444	hsa-miR-4455	CLIP-seq
MIRT2559445	hsa-miR-4472	CLIP-seq
MIRT2258683	hsa-miR-4477b	CLIP-seq
MIRT2258684	hsa-miR-4487	CLIP-seq
MIRT2258685	hsa-miR-4490	CLIP-seq
MIRT2258688	hsa-miR-4517	CLIP-seq
MIRT2559446	hsa-miR-4538	CLIP-seq
MIRT2559447	hsa-miR-4642	CLIP-seq
MIRT2559448	hsa-miR-4644	CLIP-seq
MIRT2027381	hsa-miR-4647	CLIP-seq
MIRT2027382	hsa-miR-4662b	CLIP-seq
MIRT2258693	hsa-miR-4663	CLIP-seq
MIRT2027383	hsa-miR-4699-5p	CLIP-seq
MIRT1100574	hsa-miR-4701-3p	CLIP-seq
MIRT2559449	hsa-miR-4723-5p	CLIP-seq
MIRT1100577	hsa-miR-4761-5p	CLIP-seq
MIRT2559450	hsa-miR-4772-3p	CLIP-seq
MIRT2258704	hsa-miR-4774-5p	CLIP-seq
MIRT2559451	hsa-miR-4791	CLIP-seq
MIRT2027385	hsa-miR-4803	CLIP-seq
MIRT2258709	hsa-miR-491-5p	CLIP-seq
MIRT1100579	hsa-miR-500b	CLIP-seq
MIRT1100580	hsa-miR-501-5p	CLIP-seq
MIRT2258712	hsa-miR-5096	CLIP-seq
MIRT2559452	hsa-miR-544	CLIP-seq
MIRT2559453	hsa-miR-548a-5p	CLIP-seq
MIRT2559454	hsa-miR-548ab	CLIP-seq
MIRT2559455	hsa-miR-548ad	CLIP-seq
MIRT1100590	hsa-miR-548ag	CLIP-seq
MIRT1100591	hsa-miR-548ai	CLIP-seq
MIRT2559456	hsa-miR-548ak	CLIP-seq
MIRT2559457	hsa-miR-548b-5p	CLIP-seq
MIRT1100625	hsa-miR-548c-3p	CLIP-seq
MIRT2559458	hsa-miR-548c-5p	CLIP-seq
MIRT2559459	hsa-miR-548d-5p	CLIP-seq
MIRT2559460	hsa-miR-548h	CLIP-seq
MIRT2559461	hsa-miR-548i	CLIP-seq
MIRT2559462	hsa-miR-548j	CLIP-seq
MIRT2559463	hsa-miR-548k	CLIP-seq
MIRT2258721	hsa-miR-548l	CLIP-seq
MIRT2027389	hsa-miR-548n	CLIP-seq
MIRT2559464	hsa-miR-548p	CLIP-seq
MIRT2559465	hsa-miR-548w	CLIP-seq
MIRT2559466	hsa-miR-548y	CLIP-seq
MIRT1100596	hsa-miR-554	CLIP-seq
MIRT2559467	hsa-miR-559	CLIP-seq
MIRT2559468	hsa-miR-562	CLIP-seq
MIRT1100598	hsa-miR-595	CLIP-seq
MIRT2027393	hsa-miR-616	CLIP-seq
MIRT2559469	hsa-miR-628-5p	CLIP-seq
MIRT2559470	hsa-miR-676	CLIP-seq
MIRT2258729	hsa-miR-7	CLIP-seq
MIRT2559423	hsa-miR-1197	CLIP-seq
MIRT2258623	hsa-miR-1205	CLIP-seq
MIRT2258629	hsa-miR-1248	CLIP-seq
MIRT1100604	hsa-miR-1273f	CLIP-seq
MIRT2683667	hsa-miR-129-5p	CLIP-seq
MIRT2559424	hsa-miR-1322	CLIP-seq
MIRT1100517	hsa-miR-1323	CLIP-seq
MIRT2559425	hsa-miR-142-5p	CLIP-seq
MIRT2258639	hsa-miR-1825	CLIP-seq
MIRT2559427	hsa-miR-185	CLIP-seq
MIRT2258640	hsa-miR-199b-5p	CLIP-seq
MIRT2559429	hsa-miR-2276	CLIP-seq
MIRT2683668	hsa-miR-296-5p	CLIP-seq
MIRT2258647	hsa-miR-3117-5p	CLIP-seq
MIRT2683669	hsa-miR-3127-3p	CLIP-seq
MIRT2683670	hsa-miR-3130-5p	CLIP-seq
MIRT2559431	hsa-miR-3135	CLIP-seq
MIRT2559432	hsa-miR-3151	CLIP-seq
MIRT2258651	hsa-miR-3158-5p	CLIP-seq
MIRT2390024	hsa-miR-3175	CLIP-seq
MIRT1100540	hsa-miR-3185	CLIP-seq
MIRT2559434	hsa-miR-3201	CLIP-seq
MIRT1100545	hsa-miR-3613-3p	CLIP-seq
MIRT1100547	hsa-miR-3622a-5p	CLIP-seq
MIRT2559435	hsa-miR-3646	CLIP-seq
MIRT2683671	hsa-miR-3671	CLIP-seq
MIRT1100553	hsa-miR-3675-3p	CLIP-seq
MIRT2683672	hsa-miR-3676	CLIP-seq
MIRT1100554	hsa-miR-3688-3p	CLIP-seq
MIRT2559436	hsa-miR-369-5p	CLIP-seq
MIRT1100558	hsa-miR-3942-3p	CLIP-seq
MIRT2559437	hsa-miR-3976	CLIP-seq
MIRT2683673	hsa-miR-412	CLIP-seq
MIRT2683674	hsa-miR-4272	CLIP-seq
MIRT2559438	hsa-miR-4276	CLIP-seq
MIRT2559439	hsa-miR-4306	CLIP-seq
MIRT2258675	hsa-miR-4317	CLIP-seq
MIRT2559440	hsa-miR-433	CLIP-seq
MIRT2258678	hsa-miR-4423-3p	CLIP-seq
MIRT2559441	hsa-miR-4427	CLIP-seq
MIRT2027379	hsa-miR-4436b-5p	CLIP-seq
MIRT2559442	hsa-miR-4447	CLIP-seq
MIRT2559443	hsa-miR-4453	CLIP-seq
MIRT2559444	hsa-miR-4455	CLIP-seq
MIRT2559445	hsa-miR-4472	CLIP-seq
MIRT2258683	hsa-miR-4477b	CLIP-seq
MIRT2683675	hsa-miR-4482	CLIP-seq
MIRT2258684	hsa-miR-4487	CLIP-seq
MIRT2258685	hsa-miR-4490	CLIP-seq
MIRT2683676	hsa-miR-450b-5p	CLIP-seq
MIRT2258688	hsa-miR-4517	CLIP-seq
MIRT2559446	hsa-miR-4538	CLIP-seq
MIRT2559447	hsa-miR-4642	CLIP-seq
MIRT2559448	hsa-miR-4644	CLIP-seq
MIRT2258695	hsa-miR-4686	CLIP-seq
MIRT1100572	hsa-miR-4694-3p	CLIP-seq
MIRT2027383	hsa-miR-4699-5p	CLIP-seq
MIRT2559449	hsa-miR-4723-5p	CLIP-seq
MIRT1100577	hsa-miR-4761-5p	CLIP-seq
MIRT2559450	hsa-miR-4772-3p	CLIP-seq
MIRT2258704	hsa-miR-4774-5p	CLIP-seq
MIRT2559451	hsa-miR-4791	CLIP-seq
MIRT2258709	hsa-miR-491-5p	CLIP-seq
MIRT2258712	hsa-miR-5096	CLIP-seq
MIRT2683677	hsa-miR-518a-5p	CLIP-seq
MIRT2683678	hsa-miR-527	CLIP-seq
MIRT2559452	hsa-miR-544	CLIP-seq
MIRT2559453	hsa-miR-548a-5p	CLIP-seq
MIRT2559454	hsa-miR-548ab	CLIP-seq
MIRT2559455	hsa-miR-548ad	CLIP-seq
MIRT2027386	hsa-miR-548ae	CLIP-seq
MIRT1100590	hsa-miR-548ag	CLIP-seq
MIRT1100591	hsa-miR-548ai	CLIP-seq
MIRT2027387	hsa-miR-548aj	CLIP-seq
MIRT2559456	hsa-miR-548ak	CLIP-seq
MIRT2027388	hsa-miR-548am	CLIP-seq
MIRT2559457	hsa-miR-548b-5p	CLIP-seq
MIRT1100625	hsa-miR-548c-3p	CLIP-seq
MIRT2559458	hsa-miR-548c-5p	CLIP-seq
MIRT2559459	hsa-miR-548d-5p	CLIP-seq
MIRT2559460	hsa-miR-548h	CLIP-seq
MIRT2559461	hsa-miR-548i	CLIP-seq
MIRT2559462	hsa-miR-548j	CLIP-seq
MIRT2559463	hsa-miR-548k	CLIP-seq
MIRT2258721	hsa-miR-548l	CLIP-seq
MIRT2027389	hsa-miR-548n	CLIP-seq
MIRT1100594	hsa-miR-548o	CLIP-seq
MIRT2559464	hsa-miR-548p	CLIP-seq
MIRT2559465	hsa-miR-548w	CLIP-seq
MIRT2027390	hsa-miR-548x	CLIP-seq
MIRT2559466	hsa-miR-548y	CLIP-seq
MIRT1100596	hsa-miR-554	CLIP-seq
MIRT2559467	hsa-miR-559	CLIP-seq
MIRT2559468	hsa-miR-562	CLIP-seq
MIRT2683679	hsa-miR-607	CLIP-seq
MIRT2027393	hsa-miR-616	CLIP-seq
MIRT2559469	hsa-miR-628-5p	CLIP-seq
MIRT2258729	hsa-miR-7	CLIP-seq
MIRT1100601	hsa-miR-877	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
MYC	Activation	21252116

Show/Hide all(69)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	TAS
GO:0000165	Process	MAPK cascade	IEA
GO:0000165	Process	MAPK cascade	TAS
GO:0000166	Function	Nucleotide binding	IEA
GO:0001889	Process	Liver development	IEA
GO:0003924	Function	GTPase activity	IBA
GO:0003924	Function	GTPase activity	IEA
GO:0003924	Function	GTPase activity	IMP	26037647
GO:0003924	Function	GTPase activity	TAS
GO:0003925	Function	G protein activity	IEA
GO:0005515	Function	Protein binding	IPI	10673434, 12732644, 15451670, 20080631, 20802526, 24415755, 25416956, 25852190, 28619714, 30194290, 31980649, 32814053
GO:0005525	Function	GTP binding	IBA
GO:0005525	Function	GTP binding	IEA
GO:0005737	Component	Cytoplasm	IDA	23698361
GO:0005737	Component	Cytoplasm	IEA
GO:0005741	Component	Mitochondrial outer membrane	TAS
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	28619714
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0007165	Process	Signal transduction	IEA
GO:0007265	Process	Ras protein signal transduction	IBA
GO:0007265	Process	Ras protein signal transduction	IEA
GO:0007565	Process	Female pregnancy	IEA
GO:0008283	Process	Cell population proliferation	IEA
GO:0008542	Process	Visual learning	IEA
GO:0009629	Process	Response to gravity	IEA
GO:0009898	Component	Cytoplasmic side of plasma membrane	IDA	23698361
GO:0010467	Process	Gene expression	IEA
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0010628	Process	Positive regulation of gene expression	IMP	22065586
GO:0012505	Component	Endomembrane system	IEA
GO:0014009	Process	Glial cell proliferation	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0016601	Process	Rac protein signal transduction	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0019002	Function	GMP binding	IEA
GO:0019003	Function	GDP binding	IBA
GO:0019003	Function	GDP binding	IEA
GO:0019221	Process	Cytokine-mediated signaling pathway	IEA
GO:0021897	Process	Forebrain astrocyte development	IEA
GO:0030036	Process	Actin cytoskeleton organization	IEA
GO:0030275	Function	LRR domain binding	IEA
GO:0030857	Process	Negative regulation of epithelial cell differentiation	IEA
GO:0032228	Process	Regulation of synaptic transmission, GABAergic	IEA
GO:0035022	Process	Positive regulation of Rac protein signal transduction	IEA
GO:0035900	Process	Response to isolation stress	IEA
GO:0035914	Process	Skeletal muscle cell differentiation	IEA
GO:0042802	Function	Identical protein binding	IPI	26051715
GO:0043495	Function	Protein-membrane adaptor activity	IEA
GO:0043524	Process	Negative regulation of neuron apoptotic process	IEA
GO:0044877	Function	Protein-containing complex binding	IDA	23209302
GO:0048169	Process	Regulation of long-term neuronal synaptic plasticity	IEA
GO:0048873	Process	Homeostasis of number of cells within a tissue	IEA
GO:0051146	Process	Striated muscle cell differentiation	IEA
GO:0051384	Process	Response to glucocorticoid	IEA
GO:0051385	Process	Response to mineralocorticoid	IEA
GO:0051402	Process	Neuron apoptotic process	IEA
GO:0051450	Process	Myoblast proliferation	IEA
GO:0060038	Process	Cardiac muscle cell proliferation	IEA
GO:0060252	Process	Positive regulation of glial cell proliferation	IEA
GO:0060441	Process	Epithelial tube branching involved in lung morphogenesis	IEA
GO:0060509	Process	Type I pneumocyte differentiation	IEA
GO:2000774	Process	Positive regulation of cellular senescence	IEA

MIM	HGNC	e!Ensembl
190070	6407	ENSG00000133703

Protein

UniProt ID

P01116

Protein name

GTPase KRas (EC 3.6.5.2) (K-Ras 2) (Ki-Ras) (c-K-ras) (c-Ki-ras) [Cleaved into: GTPase KRas, N-terminally processed]

Protein function

Ras proteins bind GDP/GTP and possess intrinsic GTPase activity (PubMed:20949621, PubMed:39809765). Plays an important role in the regulation of cell proliferation (PubMed:22711838, PubMed:23698361). Plays a role in promoting oncogenic events by

PDB

1D8D , 1D8E , 1KZO , 1KZP , 1N4P , 1N4Q , 1N4R , 1N4S , 2MSC , 2MSD , 2MSE , 3GFT , 4DSN , 4DSO , 4EPR , 4EPT , 4EPV , 4EPW , 4EPX , 4EPY , 4L8G , 4LDJ , 4LPK , 4LRW , 4LUC , 4LV6 , 4LYF , 4LYH , 4LYJ , 4M1O , 4M1S , 4M1T , 4M1W , 4M1Y , 4M21 , 4M22 , 4NMM , 4OBE , 4PZY , 4PZZ , 4Q01 , 4Q02 , 4Q03 , 4QL3 , 4TQ9 , 4TQA , 4WA7 , 5F2E , 5KYK , 5MLA , 5MLB

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00071	Ras	5 → 165	Ras family	Domain

Sequence

MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL
PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGC
VKIKKCIIM

Sequence length

189

Interactions

View interactions

	KEGG		Reactome
	EGFR tyrosine kinase inhibitor resistance Endocrine resistance MAPK signaling pathway ErbB signaling pathway Ras signaling pathway Rap1 signaling pathway Chemokine signaling pathway FoxO signaling pathway Sphingolipid signaling pathway Phospholipase D signaling pathway Mitophagy - animal Autophagy - animal mTOR signaling pathway PI3K-Akt signaling pathway Apoptosis Longevity regulating pathway Longevity regulating pathway - multiple species Cellular senescence Axon guidance VEGF signaling pathway Apelin signaling pathway Gap junction Signaling pathways regulating pluripotency of stem cells C-type lectin receptor signaling pathway Natural killer cell mediated cytotoxicity T cell receptor signaling pathway B cell receptor signaling pathway Fc epsilon RI signaling pathway Thermogenesis Long-term potentiation Neurotrophin signaling pathway Cholinergic synapse Serotonergic synapse Long-term depression Regulation of actin cytoskeleton Insulin signaling pathway GnRH signaling pathway Progesterone-mediated oocyte maturation Estrogen signaling pathway Melanogenesis Prolactin signaling pathway Thyroid hormone signaling pathway Oxytocin signaling pathway Relaxin signaling pathway GnRH secretion AGE-RAGE signaling pathway in diabetic complications Growth hormone synthesis, secretion and action Aldosterone-regulated sodium reabsorption Alzheimer disease Pathways of neurodegeneration - multiple diseases Alcoholism Hepatitis C Hepatitis B Human cytomegalovirus infection Human papillomavirus infection Human T-cell leukemia virus 1 infection Kaposi sarcoma-associated herpesvirus infection Human immunodeficiency virus 1 infection Pathways in cancer Viral carcinogenesis Proteoglycans in cancer MicroRNAs in cancer Chemical carcinogenesis - receptor activation Chemical carcinogenesis - reactive oxygen species Colorectal cancer Renal cell carcinoma Pancreatic cancer Endometrial cancer Glioma Prostate cancer Thyroid cancer Melanoma Bladder cancer Chronic myeloid leukemia Acute myeloid leukemia Non-small cell lung cancer Breast cancer Hepatocellular carcinoma Gastric cancer Central carbon metabolism in cancer Choline metabolism in cancer PD-L1 expression and PD-1 checkpoint pathway in cancer Lipid and atherosclerosis		Activation of RAS in B cells Constitutive Signaling by Ligand-Responsive EGFR Cancer Variants SHC1 events in ERBB4 signaling Signaling by SCF-KIT p38MAPK events GRB2 events in EGFR signaling SHC1 events in EGFR signaling Downstream signal transduction GRB2 events in ERBB2 signaling Tie2 Signaling EGFR Transactivation by Gastrin DAP12 signaling FCERI mediated MAPK activation NCAM signaling for neurite out-growth Ca2+ pathway VEGFR2 mediated cell proliferation CD209 (DC-SIGN) signaling Constitutive Signaling by EGFRvIII SHC-mediated cascade:FGFR1 FRS-mediated FGFR1 signaling SHC-mediated cascade:FGFR2 FRS-mediated FGFR2 signaling SHC-mediated cascade:FGFR3 FRS-mediated FGFR3 signaling FRS-mediated FGFR4 signaling SHC-mediated cascade:FGFR4 Signaling by FGFR2 in disease Signaling by FGFR4 in disease Signaling by FGFR1 in disease Regulation of RAS by GAPs RAF activation RAF/MAP kinase cascade MAP2K and MAPK activation Negative regulation of MAPK pathway Signaling by moderate kinase activity BRAF mutants Signaling by high-kinase activity BRAF mutants Signaling by BRAF and RAF fusions RAS signaling downstream of NF1 loss-of-function variants Paradoxical activation of RAF signaling by kinase inactive BRAF PTK6 Regulates RHO GTPases, RAS GTPase and MAP kinases MET activates RAS signaling Signaling by FGFR3 fusions in cancer Signaling by FGFR3 point mutants in cancer RUNX3 regulates p14-ARF FLT3 Signaling Constitutive Signaling by Overexpressed ERBB2 Estrogen-stimulated signaling through PRKCZ RAS GTPase cycle mutants Signaling downstream of RAS mutants Signaling by ERBB2 KD Mutants Signaling by ERBB2 ECD mutants Signaling by ERBB2 TMD/JMD mutants Signaling by PDGFRA transmembrane, juxtamembrane and kinase domain mutants Signaling by PDGFRA extracellular domain mutants

Show/Hide Causal Diseases (22)

Disease merge term	Disease name	dbSNP ID	References
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Cardiofaciocutaneous syndrome	cardio-facio-cutaneous syndrome	rs387907205, rs104894359	N/A
Cardiofaciocutaneous Syndrome	cardiofaciocutaneous syndrome 2	rs104894360, rs104894361, rs104894362, rs121913530, rs387907205, rs387907206, rs104894359, rs104894366	N/A
Encephalocraniocutaneous Lipomatosis	encephalocraniocutaneous lipomatosis	rs121913538, rs770248150	N/A
lung cancer	Lung cancer	rs121913529, rs121913530	N/A
Lung carcinoma	non-small cell lung carcinoma	rs121913535, rs121913238, rs121913530, rs112445441, rs727503108, rs397517040, rs121913240, rs121913529, rs17851045, rs727503106	N/A
Myelomonocytic Leukemia	juvenile myelomonocytic leukemia	rs121913530, rs112445441, rs121913529	N/A
neoplasm	Neoplasm	rs121913530, rs121913538, rs121913236, rs121913529, rs730880472, rs121913240	N/A
Noonan Syndrome	noonan syndrome, noonan syndrome 1, noonan syndrome 3, Noonan syndrome and Noonan-related syndrome	rs727504662, rs104894366, rs104894360, rs1135401776, rs730880471, rs104894364, rs193929331, rs1555194026, rs1592808357, rs104894365, rs1592798693, rs397517041, rs397517042, rs202247812, rs727503110, rs104894359, rs104894367 View all (2 more)	N/A
Prostate Cancer, Hereditary	prostate cancer, hereditary, 1	rs193929331	N/A
acute myeloid leukemia	Acute myeloid leukemia	rs606231202	N/A
Adenocarcinoma	adenoid cystic carcinoma	rs121913530	N/A
ardiofaciocutaneous syndrome	Cardiofaciocutaneous syndrome 1	rs727503109	N/A
Autoimmune Lymphoproliferative Disorder	Autoimmune lymphoproliferative syndrome type 4	rs121913535, rs112445441, rs121913529, rs121913527	N/A
Breast Adenocarcinoma	breast adenocarcinoma	rs112445441	N/A
cerebral arteriovenous malformation	Cerebral arteriovenous malformation	rs121913529, rs17851045	N/A
Endometrial carcinoma	endometrial carcinoma	rs121913530, rs104894365	N/A
gallbladder cancer	Gallbladder cancer	rs121913529, rs121913530	N/A
gastric cancer	Gastric cancer	rs121913530	N/A
lung adenocarcinoma	Lung adenocarcinoma	rs121913530	N/A
lung carcinoma	Lung carcinoma	rs121913530	N/A
medullary thyroid carcinoma	Medullary thyroid carcinoma	rs121913240	N/A
Multiple myeloma	multiple myeloma	rs121913240, rs121913527, rs121913529	N/A

Show/Hide Unknown Diseases (6)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Costello Syndrome	Costello syndrome	N/A	N/A	GenCC
Epidermal nevus syndrome	linear nevus sebaceous syndrome	N/A	N/A	GenCC
Hodgkin Lymphoma	Classic Hodgkin lymphoma	N/A	N/A	ClinVar
Hypertrophic Cardiomyopathy	Primary familial hypertrophic cardiomyopathy	N/A	N/A	ClinVar
Oligodendroglioma	Oligodendroglioma	N/A	N/A	GWAS
Sarcoma	sarcoma	N/A	N/A	ClinVar

Show/Hide Text Mining Associations (574)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
3 methylcrotonyl CoA carboxylase 1 deficiency	Associate	35794233
Aberrant Crypt Foci	Associate	12000733, 17487400, 29222172
Abnormalities Drug Induced	Associate	15923430
Abortion Spontaneous	Associate	34787849
Achondroplasia	Associate	30355600
Acrospiroma	Associate	10543256
Acute erythroleukemia	Associate	30385823
Adenoameloblastoma	Associate	30643167, 37093491
Adenocarcinoma	Associate	10517904, 10945494, 11461083, 11592777, 11882817, 12163385, 12606951, 12673679, 14511407, 1486847, 15492756, 16533793, 16598760, 1685441, 16896030 View all (171 more)
Adenocarcinoma	Stimulate	9460997
Adenocarcinoma Bronchiolo Alveolar	Associate	17071580, 17591931, 19844187, 20521350, 20661086, 21387273, 29846186, 33400370
Adenocarcinoma Clear Cell	Associate	37697729
Adenocarcinoma Follicular	Associate	17660800, 24820091, 34171097
Adenocarcinoma Mucinous	Associate	10374765, 11592777, 12196370, 16118624, 1656759, 17591931, 18386236, 19358724, 19415731, 19574674, 19855375, 20661086, 20686305, 21387273, 22314188 View all (55 more)
Adenocarcinoma of Lung	Associate	10646897, 11461083, 12606951, 15696205, 16153921, 17459062, 17487277, 17591931, 18303429, 18379350, 18776048, 18794081, 19794967, 19826477, 19854534 View all (231 more)
Adenocarcinoma Papillary	Associate	37945587
Adenolymphoma	Associate	36752878
Adenoma	Associate	10323885, 10362811, 10638959, 10661623, 10681434, 11310641, 11531254, 11815980, 12163385, 15083190, 15623940, 15832194, 16456810, 1685441, 16879389 View all (64 more)
Adenoma Islet Cell	Associate	20492682, 23370766, 26883113
Adenoma Pleomorphic	Associate	14990969, 21626008, 34380837
Adenoma Villous	Associate	22729813
Adenomatous Polyposis Coli	Associate	10661623, 15788729, 16943222, 17293392, 19440799, 19527492, 20196079, 21347319, 22481281, 22510757, 22808230, 23599153, 24518836, 24603588, 27563825 View all (5 more)
Adenomatous Polyps	Associate	15096565, 9600124
Adenomyosis	Associate	31857578, 36708516
Adenosarcoma of the uterus	Associate	28690098
Adrenal Gland Neoplasms	Associate	9569040
Adrenal hyperplasia 2	Associate	9514049
Adrenocortical Carcinoma	Associate	25078331, 35500219
Airway Remodeling	Associate	32093717, 32681943, 35794233
Albinism Oculocutaneous	Associate	19826477, 30891959
Alcoholism	Stimulate	18592405
Allan Herndon Dudley syndrome	Associate	30840593
Alzheimer Disease	Inhibit	40599432
Ameloblastoma	Associate	29388014, 32096304, 35689405
Androgen Insensitivity Syndrome	Associate	31747302, 37526097
Anemia Refractory with Excess of Blasts	Associate	3285909
Aneuploidy	Associate	10661623, 12210601, 15623940, 16988471, 27743339, 8686748, 9777951
Angina Stable	Associate	21519026, 28669023
Anodontia	Associate	16760302, 20496269, 28911955, 31243121, 32466784, 36351537
Anodontia	Inhibit	36937571
Anophthalmia with pulmonary hypoplasia	Associate	23565280, 27974679, 30836094, 33682329, 34298235, 35819261, 35941161, 37210549, 37866661, 39938521, 40317966
Anophthalmia with pulmonary hypoplasia	Stimulate	33747255
Anorexia	Associate	27229742
Anus Neoplasms	Associate	24021343, 29700411
Aortic Aneurysm Familial Abdominal 1	Associate	34787849
Aplasia Cutis Congenita with Epibulbar Dermoids	Associate	30891959, 35409398
Aplasia of Lacrimal and Salivary Glands	Associate	25899808
Appendiceal Neoplasms	Associate	10362811, 24149137, 28526814, 30692096
Arteriovenous Malformations	Associate	29748115, 31026472, 31891627, 32799314, 35999080, 36718590
Arthritis Rheumatoid	Associate	22615393, 34079550
Ascites	Associate	23321623
Atherosclerosis	Associate	36185329, 40441253
Atresia of small intestine	Associate	21297586, 26892442
Atrial Fibrillation	Associate	37263975
Aural Atresia Congenital	Associate	34787849
Autoimmune Diseases	Associate	21063026, 21079152, 33472608
Autoimmune Lymphoproliferative Syndrome	Associate	17517660, 21063026, 21079152, 29983389
Barrett Esophagus	Associate	20927195
Basal Cell Nevus Syndrome	Associate	36571464
Bile Duct Diseases	Associate	10940271, 17227126, 24406866, 34987644, 8178941, 9327727
Bile Duct Neoplasms	Associate	1685441, 24312577, 26168827, 31122820
Biliary Atresia	Associate	16311354, 35417072
Biliary Tract Diseases	Associate	27745798
Biliary Tract Neoplasms	Associate	10189896, 19815696, 24960403, 25632066, 28544747, 29360550, 30908307, 32100259, 33754015, 34795005, 35491432, 36089135, 37139666, 40499463, 8826860
Blast Crisis	Associate	2645949
Blood Platelet Disorders	Associate	35285386
Bone Diseases Metabolic	Associate	40549756
Bone Marrow Diseases	Associate	39210558
Bone Marrow Neoplasms	Associate	8839865
Brain Neoplasms	Associate	20031968, 20604919, 22795503, 25155157, 26077004, 26552420, 26563370, 27999344, 28594414, 29496399, 30120912, 30412573, 30896620, 31287555, 33024263 View all (4 more)
Breast Neoplasms	Associate	15756272, 17314276, 19820367, 20676756, 21392397, 21435948, 22258408, 22436609, 22538770, 22662244, 22701724, 23155392, 23317280, 23555992, 23982413 View all (39 more)
Breast Neoplasms	Stimulate	37070675
Brenner Tumor	Associate	31695154
Bronchial Diseases	Associate	26823891
Brunner Syndrome	Associate	36707100
Cachexia	Associate	27485414, 39289671
Cafe au Lait Spots	Associate	32388560
Calcinosis Cutis	Associate	17375050, 22481281, 22584434, 22617127, 22674181, 23975858, 25781862, 26135109, 26448020, 26892442, 27039744, 27043547, 28058585, 28404754, 29842993 View all (10 more)
Cancer Pain	Associate	34282807
Capillary Malformation Arteriovenous Malformation	Associate	29298116, 31026472
Capillary Malformations Congenital 1	Associate	32093717
Carbamoyl Phosphate Synthase I Deficiency Disease	Associate	26307133
Carcinogenesis	Associate	10517904, 10638959, 10748874, 11461083, 11815980, 12196370, 15493579, 15843421, 16456810, 16672071, 16854216, 16997920, 17451198, 18221484, 18268007 View all (81 more)
Carcinogenesis	Stimulate	22589270
Carcinoid Tumor	Associate	29422640, 33037134, 40234130, 9514049
Carcinoma	Associate	1656759, 23599154, 26339434, 26479291, 28368426, 32590950, 34797780, 7856726
Carcinoma Acinar Cell	Associate	37029223
Carcinoma Adenoid Cystic	Associate	25899808
Carcinoma Adenosquamous	Associate	19270646, 22228640, 26197069, 26923333, 28950878, 29185262, 31958074, 36355420, 36790480, 37029223, 38229035
Carcinoma Basal Cell	Associate	2179417, 34293517
Carcinoma Bronchogenic	Associate	25926253
Carcinoma Ductal	Associate	10374765, 27108388, 30798329, 30813596
Carcinoma Ductal Breast	Associate	25921169, 30946870, 37070675
Carcinoma Endometrioid	Associate	21984976, 22653804, 23851676, 29303928, 30315273, 36695555, 7856726
Carcinoma Hepatocellular	Associate	11286481, 22190283, 22258409, 26535719, 28230018, 30685691, 31363003, 35110505, 39367333
Carcinoma in Situ	Associate	35173208, 36812689, 9351717
Carcinoma in Situ	Stimulate	36812689
Carcinoma Intraductal Noninfiltrating	Associate	15040037
Carcinoma Large Cell	Associate	12606951, 14511407, 23196793, 26317919, 26430808, 26486077, 26898325, 26960398, 30048458, 30978501
Carcinoma Neuroendocrine	Associate	25142799, 26226847, 31557757, 34326338, 34647903, 36807750, 37086484, 37866661
Carcinoma Non Small Cell Lung	Associate	10945494, 11511786, 11778648, 11932909, 12606951, 14511407, 15112277, 16533793, 16598760, 17184525, 17384680, 17409862, 17452778, 17575133, 17596643 View all (423 more)
Carcinoma Non Small Cell Lung	Stimulate	17951244
Carcinoma Ovarian Epithelial	Associate	1656759, 19638206, 21098618, 21385923, 22139083, 23791828, 23800114, 24552817, 24936796, 25204737, 31898667, 32599986, 34615547
Carcinoma Pancreatic Ductal	Associate	11302964, 15040037, 15655549, 16425381, 17353198, 18075308, 19208745, 20179210, 20473902, 20801877, 21063957, 21262926, 21825040, 22086851, 22160930 View all (150 more)
Carcinoma Papillary	Associate	19898424, 22766790, 25840541, 28830562, 32093717, 7559096, 9351717
Carcinoma Papillary Follicular	Associate	25648502
Carcinoma Renal Cell	Associate	19349352, 24802662, 25811077, 25969368, 26289340, 26486077, 27144525, 27174587, 27393506, 28315738, 29489023, 31534204, 31953522, 33023600, 35074757 View all (5 more)
Carcinoma Signet Ring Cell	Associate	11592777, 22522845, 28453172, 31406299, 37355152
Carcinoma Small Cell	Associate	16045543, 24422746, 33888337, 34380837, 36812376
Carcinoma Squamous Cell	Associate	18289366, 20881644, 21330833, 21411223, 2179417, 22067401, 22228640, 22272089, 22491422, 23026567, 23093229, 23637996, 24810493, 25072932, 25173530 View all (16 more)
Carcinosarcoma	Associate	22653804, 28292439, 30194005, 32114514, 37013353, 37530323, 7856726
Cardiofaciocutaneous syndrome	Associate	17056636, 17483702, 18854871, 19156172, 20602484, 21062266, 23379592, 28594414, 30012129, 35509048, 35524774, 37510243
Cardiomyopathy Hypertrophic	Associate	30732632, 32078254
Cardiomyopathy infantile histiocytoid	Associate	27234382, 33203919
Cardiovascular Diseases	Associate	32929052
Cataract congenital with microcornea or slight microphthalmia	Stimulate	23811327
Cayler cardiofacial syndrome	Associate	11819789
Cecal Neoplasms	Associate	24018598
Cell Transformation Neoplastic	Associate	22383492, 24913817
Cell Transformation Viral	Associate	21169357, 37468622, 37846894
Cementoma	Associate	37995913
Central Nervous System Infections	Associate	37678673
Cerebral Palsy Ataxic Autosomal Recessive	Associate	35190375, 37029223
Cerebrooculofacioskeletal Syndrome 1	Associate	37995913
Chemical and Drug Induced Liver Injury	Associate	25636086
Cherubism	Associate	30385747
Cholangiocarcinoma	Associate	11034592, 11171833, 12692057, 17294242, 20565817, 20864634, 21303542, 24139215, 24186137, 24406866, 24563076, 24867389, 25526346, 25536104, 26189129 View all (37 more)
Cholangitis Sclerosing	Associate	11171833, 20864634, 35554535, 35897137, 36252869
Choledochal Cyst	Associate	32295706
Cholestasis	Associate	12189555
Chromosomal Instability	Associate	23052130, 23165447, 32571252, 32635826, 36308376, 37039257
Chromosome 12 12p trisomy	Associate	27450488
Chromosome 20 trisomy	Stimulate	21472139
Chromosome 7 monosomy	Associate	1991170, 31250550
Chromosome 7 trisomy mosaic	Associate	35409398
Colitis	Associate	8160776
Colitis Associated Neoplasms	Associate	39390564
Colitis Ulcerative	Associate	10323884, 10517904, 10595736, 1773797, 1854618, 21557394, 38302916, 8160776
Colonic Diseases	Associate	1685441, 23348904, 28179590, 32792368, 33331426
Colonic Neoplasms	Associate	10496348, 10732765, 11156646, 11355359, 14965444, 15037663, 15493579, 15812479, 15923430, 16356174, 16534842, 17237286, 17352027, 17636402, 17729418 View all (52 more)
Colonic Polyps	Associate	16937524, 18782444, 25496852, 26910894, 28953955, 9203947
Colorectal Neoplasms	Associate	10471035, 10496348, 10639144, 11055588, 11156646, 11192825, 11290569, 11531254, 11754204, 11819789, 11856481, 11953860, 12093899, 12196370, 12210601 View all (1185 more)
Colorectal Neoplasms	Stimulate	35894141
Colorectal Neoplasms Hereditary Nonpolyposis	Associate	15788729, 18435933, 20102720, 22481281, 24196786, 29596542, 35638907, 9777938
Complement Component 7 Deficiency	Associate	32384877
Congenital Abnormalities	Associate	32613723
Congenital Hereditary and Neonatal Diseases and Abnormalities	Associate	17412879, 23972113
Congenital myasthenic syndrome ib	Associate	29518181
Constriction Pathologic	Associate	10940271, 20864634, 26168827, 35417072
Costello Syndrome	Associate	16773572, 17056636, 17412879, 17517660, 25914166, 26572961, 27589201, 28371260, 30012129, 30355600
Craniocerebral Trauma	Associate	29789649
Crazy paving pattern	Associate	25361983, 36029220
Crohn Disease	Associate	29967250
Crohn Disease	Stimulate	9207270
Cushing Syndrome	Associate	9569040
Cystadenocarcinoma	Associate	9671070
Cystadenoma Serous	Associate	27141064, 38450993
Cystic Fibrosis	Associate	10517912, 23743931, 32792597, 32847795, 35964683, 9671070
Cysts	Associate	19415731, 23743931, 26253305, 29660844, 29866630, 30936197, 32792597, 32847795, 35229208, 39567272
Daneman Davy Mancer syndrome	Associate	23321623
Davenport Donlan syndrome	Associate	28371260
Death	Associate	12196370, 12210601, 23374602, 26715198, 29223986, 30197261, 31122820, 31659106, 32376889, 32791343, 35866409, 37140194, 37728512
Depressive Disorder	Associate	27468967, 33512809
Dermatitis Atopic	Associate	33289509
Desmoplastic Small Round Cell Tumor	Associate	25119929
Developmental Disabilities	Associate	27450488, 29948256, 30012129, 35441233, 38085330
Diabetic Foot	Associate	30012129, 33314661
Diabetic Retinopathy	Associate	23209562
Diarrhea	Associate	21847063, 27229742, 30936194
Digestive System Neoplasms	Associate	37771286
Disease	Associate	10748874, 25444464, 31195179, 33555095, 40104288, 8612201
Disease Progression	Associate	34381078
Down Syndrome	Associate	25105841
Drug Related Side Effects and Adverse Reactions	Associate	19540195, 23236152, 25946136, 27938998, 28031235, 29596542, 32892548, 36172682, 36661686, 36901764, 40570703
Dry Eye Syndromes	Associate	27938998
Ductus Arteriosus Patent	Associate	19878864, 27649783
Dyskinesia Drug Induced	Associate	39871125
Dyslipidemias	Associate	25158139
Dysplastic Nevus Syndrome	Associate	22178590, 32543103, 8160776
Ectodermal Dysplasia	Associate	20824047, 32466769
Ectrodactyly Ectodermal Dysplasia And Cleft Lip Palate Syndrome 1	Associate	25677978, 36695555
Encephalitis Herpes Simplex	Associate	30042065
Encephalocraniocutaneous lipomatosis	Associate	35409398
Endodermal Sinus Tumor	Associate	34117242
Endometrial Hyperplasia	Associate	10748874, 19419940, 25415225, 28951454, 30121391, 30430425
Endometrial Neoplasms	Associate	12015762, 17170014, 17388789, 1812593, 18221484, 18469797, 18757403, 19820367, 20218740, 22146979, 22266936, 22383975, 22653804, 22706224, 23300780 View all (24 more)
Endometriosis	Associate	23010532, 25361550, 28489996, 30110635, 30428062, 31790621, 33675098, 33805315, 36977195
Enteritis	Associate	28953659, 30723296, 35172862, 35901658
Epidermal Nevus	Associate	25928347, 26804118, 35409398
Epilepsies Partial	Associate	31659111
Epilepsy	Associate	26521233, 34649968
Epileptic Encephalopathy Early Infantile 3	Associate	25941399
Epstein Barr Virus Infections	Associate	33297669
Erdheim Chester Disease	Associate	25324352, 27940476, 32852896
Esophageal Neoplasms	Associate	18592405, 22448886, 23464485, 24024333, 26345812, 27107065, 29116623, 35780460
Esophageal Squamous Cell Carcinoma	Associate	18592405, 22450065, 24024333, 33054840, 36466860
Esophageal Squamous Cell Carcinoma	Inhibit	29866946
Euthyroid Sick Syndromes	Associate	30840593
Evans Syndrome	Associate	30940614
Exanthema	Associate	21283802
Facial Dysmorphism with Multiple Malformations	Associate	30012129
Familial cylindromatosis	Associate	25351503, 26336083
Familial Primary Pulmonary Hypertension	Associate	35794233
Fatigue	Associate	21847063, 30936194
Fibroma Desmoplastic	Associate	34056541
Fibrosis	Associate	37169841
Flatfoot	Associate	10517904, 36812689
Florid cemento osseous dysplasia	Associate	36707318
Florid cystic endosalpingiosis of the uterus	Associate	12594239, 31576556
Focal Infection	Associate	9020477
Fox Fordyce Disease	Associate	28053287
Gallbladder Diseases	Associate	26643927, 8675098
Gallbladder Neoplasms	Associate	18176964, 24508317, 24551272, 24739824, 24867389, 25041017, 26617872, 27191262, 27620744, 27745798, 30678452, 30908307, 31122820, 34798839, 35675577, 38092180, 40499463, 8675098, 8826860 View all (4 more)
Ganglioglioma	Associate	34355449, 36973520
Gardner Syndrome	Associate	33787608
Gastro enteropancreatic neuroendocrine tumor	Associate	26684240
Gastrointestinal Diseases	Associate	34580018
Gastrointestinal Neoplasms	Associate	11156646, 1685441, 26516200, 36853786
Gastrointestinal Stromal Tumors	Associate	25239601, 25427437, 27469332, 27974047, 32236636
Gaucher like disease	Associate	33727167
Genetic Diseases Inborn	Associate	24346091, 7903667
Germinoma	Associate	27391150, 36172682
Gilbert Disease	Associate	39210558
Glioblastoma	Associate	35013227, 38225605
Glioma	Associate	22821383, 27012554, 34525976, 34681583, 37713468, 38225605
Gliosarcoma	Associate	21725518
Glucosephosphate Dehydrogenase Deficiency	Associate	26366417
Glutaric Acidemia I	Associate	25882375
Glycogen Storage Disease IIIC	Associate	29027536
Glycogen Storage Disease Type IV	Associate	25695224, 25844824, 32351996
Goiter	Associate	7559096
Granuloma Giant Cell	Associate	33622887
Granuloma Pyogenic	Associate	26802240
Granulosa Cell Tumor	Associate	28852190
Growth Disorders	Associate	17517660, 27450488
Hair Diseases	Associate	28371260
Head and Neck Neoplasms	Associate	10511729, 28844705, 35806488, 7730480
Heart Defects Congenital	Associate	23379592
Heart Diseases	Associate	23321623
Hemangioma	Associate	31486960, 32799314
Hemangiosarcoma	Associate	10735503, 11286481, 26440310
Hematologic Neoplasms	Associate	17517660, 19430420, 32277629, 34570179
Hemochromatosis	Associate	23761422
Hemoglobin SC Disease	Associate	25677978, 28418914
Hemorrhagic Stroke	Associate	35999080
Hepatitis B	Associate	21435948, 24715238, 26883104, 28053287
Hereditary Breast and Ovarian Cancer Syndrome	Associate	20647319, 20676756, 22662244, 25921169
Hereditary bundle branch system defect	Associate	34595842
Hereditary pancreatitis	Associate	19064568
Hernia Inguinal	Associate	31910207
Hippocampal Sclerosis	Associate	34649968
Histiocytic Sarcoma	Associate	30322385, 30626916, 31439678, 32852896, 37115038
Histiocytosis	Associate	34935192
Histiocytosis Langerhans Cell	Associate	32852896, 35410720, 39727013
Histiocytosis Sinus	Associate	26922062, 28664935, 36201194, 36782249
Holoprosencephaly recurrent infections and monocytosis	Associate	35766510
Hydrops Fetalis	Associate	23321623
Hydrothorax	Associate	23321623
Hyperaldosteronism	Associate	9569040
Hyperplasia	Associate	10543256, 12015762, 17618248, 19419940, 25768080, 3182322, 33099482, 9569040
Hypersensitivity Immediate	Associate	31231124
Hypertension	Associate	25158139, 35491432
Hypertrophic Neuropathy And Cataract	Associate	32388560
Hypoxia	Stimulate	16543245
Hypoxia	Associate	19843849, 20532039, 23786654, 35013227, 35659150
Hypoxia Brain	Associate	19843849, 24516257, 27863474
Idiopathic Pulmonary Fibrosis	Associate	27575421
IGHM protein human	Associate	23174937
Ileal Neoplasms	Associate	39966961
Immune System Diseases	Associate	17517660
Immunoglobulin G4 Related Disease	Associate	33472608
Immunologic Deficiency Syndromes	Associate	16943222, 23511561, 30833417, 33256375, 35460607
Infarction Middle Cerebral Artery	Associate	28640835
Inflammation	Associate	17436386, 20473400, 22481281, 23619604, 24040001, 27992614, 28539837, 30402038, 33254149, 33413474, 33675098, 38118408, 7797131
Inflammatory Bowel Diseases	Associate	21830278, 32376853, 33930428
Inflammatory Bowel Diseases	Inhibit	26764183
Intestinal Atresia	Associate	35319967
Intestinal Diseases	Associate	16997920, 26212640, 8440743
Intestinal Neoplasms	Associate	14991952, 25297496, 32602003, 32867793
Intestinal Polyposis	Associate	15083190
Intracranial Arteriovenous Malformations	Associate	29298116, 31026472, 31891627, 34214981, 34478890, 34607843, 35999080
Isodicentric Chromosome 15 Syndrome	Associate	15951308
Jaw Diseases	Associate	33622887
Joint Diseases	Associate	38302916
Keratoconus Posticus Circumscriptus with Associated Malformations	Associate	31399545
Keratosis Seborrheic	Associate	21078999
Kidney Failure Chronic	Associate	8616107
Kidney Neoplasms	Associate	24802662, 38413252
Kimura Disease	Associate	32915145
Kininogen Deficiency High Molecular Weight and Low Molecular Weight	Associate	37846894
Klatskin Tumor	Associate	31122820
Klippel Trenaunay Weber Syndrome	Associate	32613723
Langerhans Cell Sarcoma	Associate	30322385
Left sided gallbladder	Associate	27509333
Leigh Disease	Inhibit	29103024
Leigh syndrome French Canadian type	Associate	28608966
Leiomyosarcoma	Associate	37175660
LEOPARD Syndrome	Associate	17517660
Lesch Nyhan Syndrome	Associate	20496269
Leukemia	Associate	1817189, 28816792, 32188707, 34981560, 35904492, 8123851
Leukemia Biphenotypic Acute	Associate	27698462, 32164600, 38192186
Leukemia Large Granular Lymphocytic	Associate	23092099
Leukemia Lymphocytic Chronic B Cell	Associate	19383911, 21483442, 22675518, 24549645, 25523272, 26870997, 27226433, 29273082, 29358183, 30262568, 30565721, 35801373, 38280423
Leukemia Lymphoma Adult T Cell	Associate	11167822, 37832654
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	2205309, 2645949, 27221928
Leukemia Myeloid Acute	Associate	15951308, 16404744, 16969076, 20678218, 21596848, 22581002, 22912701, 24142997, 24178622, 25022553, 25381129, 26990290, 27992414, 28089908, 29227476 View all (20 more)
Leukemia Myelomonocytic Chronic	Associate	18925961, 21828135, 2205309, 24446311, 24817963, 2562924, 26648538, 31048357, 32852896, 3285909, 35443559, 38118408
Leukemia Myelomonocytic Juvenile	Associate	17332249, 18000165, 19571318, 19874312, 20008299, 20408841, 22753870, 23092099, 23696637, 26457647, 29259247, 30012129, 31250550, 33327329
Leukemia Plasma Cell	Associate	8490179
Leukemia Promyelocytic Acute	Associate	27063598
Leukemia T Cell	Associate	27698462
Leukemoid Reaction	Associate	40692166
Leukocytosis	Associate	40692166
Lichen Sclerosus et Atrophicus	Associate	17554370
Lipoma	Associate	25928347
Liver Diseases	Inhibit	24186137
Liver Diseases	Associate	24715238
Liver Failure	Associate	25896895, 29390348, 36782009
Lown Ganong Levine Syndrome	Associate	22675430, 31085763
Lung Diseases	Associate	20848283, 20975376, 23382536, 24913817, 26468985, 26887348, 27911859, 28950878, 29858031, 31228073, 31915379, 32787374, 32792368, 32823550, 33002027, 34065402, 34558391, 37972068 View all (3 more)
Lung Neoplasms	Associate	10414414, 11461083, 12606951, 1306309, 1486847, 14990969, 16175182, 16608164, 1685441, 17071580, 17233834, 17409929, 17409930, 17477876, 18594312 View all (214 more)
Lupus Erythematosus Systemic	Associate	34299244
Lupus Nephritis	Associate	36335193
Lymphangioma Cystic	Associate	23321623
Lymphatic Abnormalities	Associate	35778409
Lymphatic Diseases	Associate	23321623, 39210558
Lymphatic Metastasis	Associate	11511786, 12196370, 18779727, 19515263, 21414214, 22481281, 22537942, 22876814, 23511561, 23573237, 25337237, 25929517, 26042813, 26681025, 27020587 View all (6 more)
Lymphatic Metastasis	Stimulate	32271426
Lymphedema	Associate	29381910, 32792597, 34607843
Lymphoma	Associate	10760686
Lymphoma B Cell	Associate	15787160
Lymphoma Follicular	Associate	26457492, 36918771
Lymphoma Large B Cell Diffuse	Associate	10760686, 22343534, 22575864
Lymphoma Mantle Cell	Associate	29973234
Lymphoma Non Hodgkin	Associate	10595736, 11927008, 2511175, 30565721, 32373977, 32883742, 35801373, 38613141
Lymphoma T Cell	Associate	11896204, 12824925, 28122867
Lymphopenia	Associate	33472608
MASS syndrome	Associate	33023600
Maturity Onset Diabetes of the Young Type 8 with Exocrine Dysfunction	Associate	34580018
Mediastinal Cyst	Associate	27336603
Melanoma	Associate	11886512, 21131919, 21543894, 22869096, 25349262, 26307133, 27550813, 28170370, 28380455, 29559732, 30558566, 31492770, 31980996, 33024263, 33232779 View all (7 more)
Melanoma Cutaneous Malignant	Associate	14691295, 29349077, 32581366
Melorheostosis	Associate	28434888
Meningeal Carcinomatosis	Associate	21725518
Meningeal Neoplasms	Associate	29604399
Metabolic Side Effects of Drugs and Substances	Associate	36800626
Metabolic Syndrome	Associate	26178671
Metaphyseal chondrodysplasia Schmid type	Associate	28440393
Metaplasia	Associate	25867268, 35796805
Methylmalonic Aciduria due to Methylmalonyl CoA Mutase Deficiency	Associate	32675549, 40486872
Microphthalmia Syndromic 6	Associate	30891959
Microsatellite Instability	Stimulate	10562815
Microsatellite Instability	Associate	11127266, 15274399, 17267619, 21457162, 23348904, 23511557, 23741067, 23773459, 24885062, 24964857, 26298837, 27198570, 29116623, 29940619, 33087131 View all (7 more)
Mitochondrial Diseases	Stimulate	25714130
Mitochondrial Diseases	Associate	36150391
Mixed Tumor Malignant	Associate	28059096, 34847284
Monoclonal Gammopathy of Undetermined Significance	Associate	28550183
Mouth Diseases	Associate	16931950, 18379350, 29684357, 29974407, 31295281, 31857578, 33712927, 7835579, 9137081
Mouth Neoplasms	Associate	19380522, 20603437, 21704278, 29037125, 30643167
Mucolipidoses	Associate	8616107
Mucus Inspissation of Respiratory Tract	Associate	30072506
Mullerian aplasia	Associate	12594239
Multiple Myeloma	Associate	11520807, 16156861, 16497971, 22573403, 22939401, 24335104, 24434212, 25743686, 25894462, 2681517, 27223072, 27458004, 27634910, 27863261, 28234344 View all (22 more)
Multiple Pulmonary Nodules	Associate	20087229, 36029220
Muscular Diseases	Associate	17412879
Myasthenia Gravis	Stimulate	8286826
Myasthenia Gravis	Associate	8286826
Mycosis Fungoides	Associate	21209378
Myelodysplastic Myeloproliferative Diseases	Associate	35766510
Myelodysplastic Syndromes	Associate	12947010, 20678218, 26990290, 27992414, 31772163, 3285909, 35396491, 35766510, 36380727, 39210558, 40151938, 8123851
Myeloid splenomegaly	Associate	33472608
Myeloproliferative Disorders	Associate	28594414
Myoepithelioma	Associate	32505185
Myopathy Congenital With Excess Of Muscle Spindles	Associate	17412879
Myositis	Associate	29027536
N syndrome	Associate	20661086
Nasopharyngeal Carcinoma	Associate	20042089, 28581676, 30231694
Nausea	Associate	21847063
Necrosis	Associate	23619604
Neoplasm Invasiveness	Associate	18379350, 20473902, 25029118, 26749281, 27095449, 27518729, 37121213, 8160776, 8178941, 9351717
Neoplasm Metastasis	Associate	11882817, 15330200, 17177160, 17607370, 19056857, 19179548, 19238633, 19293803, 20020061, 20184776, 20604919, 20801877, 21330833, 21364579, 21414214 View all (140 more)
Neoplasm Metastasis	Stimulate	32271426
Neoplasm Recurrence Local	Associate	34326338
Neoplasms	Associate	10189896, 10358073, 10373591, 10394959, 10414414, 10493873, 10517904, 10522720, 10543256, 10639144, 10661623, 10737386, 10748874, 10940271, 11034592 View all (1466 more)
Neoplasms	Inhibit	20454511, 20548289, 22086851, 22121227, 23633104, 23771539, 25477374, 25744732, 29371906, 33256375, 36282188, 36455140, 37070675
Neoplasms	Stimulate	25381817, 26320455, 32271426, 37121965, 37792760
Neoplasms Adipose Tissue	Associate	35546360
Neoplasms Cystic Mucinous and Serous	Associate	10522720, 11943707, 15077125, 16721043, 18779727, 19010816, 19430562, 1955373, 19995707, 20802181, 21136228, 21387273, 22367918, 22930283, 22961878 View all (30 more)
Neoplasms Germ Cell and Embryonal	Stimulate	17970049
Neoplasms Germ Cell and Embryonal	Associate	24896186, 27905446, 36172682, 38430549
Neoplasms Glandular and Epithelial	Associate	25546727, 25899808, 27104828, 37428914
Neoplasms Squamous Cell	Associate	23026567, 25115387, 25348872, 26379152, 33358484
Neoplasms Unknown Primary	Associate	29973234, 34302033
Neoplasms Vascular Tissue	Associate	32613723
Neoplastic Syndromes Hereditary	Associate	15788729, 23773459
Nephrotic Syndrome	Associate	27997540
Neuroblastoma	Associate	26482930
Neurocutaneous Syndromes	Associate	35409398
Neuroectodermal Tumors	Associate	37160315
Neuroendocrine Tumors	Associate	25210493, 27597976, 31557757, 33005981, 37232011, 37866661, 8623922
Neurofibroma Plexiform	Associate	35797671
Neurofibromatoses	Associate	35797671
Neurofibromatosis Noonan syndrome	Associate	30953504
Neurofibrosarcoma	Associate	23722551, 25946318
Nevus	Associate	35409398
Nevus Pigmented	Associate	30359577
Nevus Sebaceous of Jadassohn	Associate	25928347, 26521233, 29381910, 30891959, 33308209, 34649968, 38273779, 39377508
Non Radiographic Axial Spondyloarthritis	Associate	18669866
Nonsyndromic Holoprosencephaly	Associate	36172682
Noonan like syndrome	Associate	28371260
Noonan Syndrome	Associate	16773572, 17056636, 17704260, 18854871, 19760651, 20186801, 20602484, 23321623, 25941399, 26572961, 30012129, 30784236, 31341022, 32078254, 35778409, 36566191, 38085330, 38254922 View all (3 more)
Obesity	Associate	25415225
Obesity	Stimulate	30402038
Obesity	Inhibit	33197880
Obesity Maternal	Associate	30402038
Oculocerebrorenal Syndrome	Associate	28378457
Oncogene Addiction	Associate	15213223, 25941399, 35091678, 36581205
Osteoarthritis	Associate	33879632, 34856957
Osteosarcoma	Associate	22006429, 29358307
Ovarian Diseases	Associate	11943707, 21136228, 21216929, 23800114, 31030485, 33675098, 34889854
Ovarian Neoplasms	Associate	10362811, 12594239, 18779727, 19240718, 19358724, 19430562, 19638206, 19995707, 20647319, 20676756, 20802181, 20826764, 21098618, 21136228, 21931712 View all (71 more)
Pancreatic Carcinoma	Associate	34895278, 38291468
Pancreatic Cyst	Associate	10517912, 21068490, 22961878, 23743931, 26253305, 28970292, 30936197, 35229208
Pancreatic Diseases	Associate	15040037, 24504548, 34580018, 7876379
Pancreatic Intraductal Neoplasms	Associate	10374765, 10517912, 11161385, 15832194, 17097223, 18343945, 18376308, 21775669, 22167000, 22367918, 23743931, 24525507, 24604757, 24897499, 25245835 View all (21 more)
Pancreatic Neoplasms	Associate	10189896, 10373591, 10374765, 10394959, 10517912, 10543256, 10656099, 11161385, 11406644, 11406647, 11986336, 12189555, 12508380, 12592366, 12759238 View all (266 more)
Pancreaticobiliary Maljunction	Associate	22807610, 9444927
Pancreatitis	Associate	12508380, 17353198, 21829508, 26892442, 27333990, 33501895, 34257550, 34433650, 35319967, 7797131, 8178941, 9327727
Pancreatitis	Stimulate	36453584
Pancreatitis Chronic	Associate	10374765, 11406644, 12189555, 15040037, 16425381, 17436386, 18075308, 27705932, 34580018, 36610378
Pancreatoblastoma	Associate	11696422
Papilloma	Associate	25056374, 30838648, 33203919, 34108636
Papilloma Inverted	Associate	29779136, 30838648
Papillomavirus Infections	Associate	16672071, 23534709, 29185262, 31960612
Paraproteinemias	Associate	26090869, 28234344, 36138464
Parathyroid Neoplasms	Associate	37121965
Parkinson Disease	Associate	24139521, 33552685, 36959222
Paroxysmal nonkinesigenic dyskinesia	Associate	30018674, 30565721
Peripheral Nervous System Diseases	Associate	32388560
Peritoneal Neoplasms	Associate	26925640, 28640835, 32648179, 32711552
Peritonitis	Associate	24307542, 24951608, 28950878, 30303876, 31571052, 31746520, 33024263, 34887523, 39289461
Persistent Mullerian duct syndrome	Associate	36827302
Personality Disorders	Associate	35775708
Peutz Jeghers Syndrome	Associate	17384680, 9378385
Philadelphia Chromosome	Associate	29997224, 30190342, 36307214
Pigmentation Disorders	Associate	27450488
Placenta Diseases	Associate	30402038
Plasmablastic Lymphoma	Associate	33225311, 33297669
Platypnea Orthodeoxia Syndrome	Associate	32753473
Pleural Diseases	Associate	21544811, 24694341, 39844176
Pleural Effusion	Associate	27518729, 31028221, 31534501, 34481168
Pleural Effusion Malignant	Associate	23736021, 31028221
Pneumocephalus	Associate	30368012
Pneumonia Aspiration	Associate	24866065
Poikiloderma with Neutropenia	Associate	25093594
Poikiloderma with Neutropenia	Inhibit	32580297
Polycythemia Vera	Associate	27509985
Polyhydramnios	Associate	23321623
Polyposis Of Gastric Fundus Without Polyposis Coli	Associate	12414520, 32543103
Polyposis Syndrome Hereditary Mixed 1	Associate	11310641, 35173208
Polyps	Associate	11839573, 12610098, 15096565, 16937524, 18782444, 20682711, 21347319, 22510757, 22808230, 23348904, 24486588, 24925057, 25216220, 25496852, 25734426 View all (10 more)
Precancerous Conditions	Associate	31576098, 32596290, 35476515, 40317966
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	2183888, 25917266, 27997540, 28408464, 30190342
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	22237106, 22675565, 24962064, 27022003, 32852896, 36077521, 36325893, 36380727
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Stimulate	3520570
Primary Immunodeficiency Diseases	Associate	30940614
Primary Myelofibrosis	Associate	31628430, 31678370, 33666653, 37846894, 38386293
Prodromal Symptoms	Associate	23534748, 28453697, 28731050, 31900123, 8616107, 9515799
Prostate Cancer Hereditary 7	Associate	35766303
Prostatic Hyperplasia	Associate	24474452
Prostatic Neoplasms	Associate	21784672, 29268752, 35659150, 7928631
Prostatic stromal proliferation of uncertain malignant potential	Associate	19010816
Prostatitis	Associate	7573356
Pruritus	Associate	27938998
Pseudomyxoma Peritonei	Associate	10362811, 26475379, 27502722, 28640835, 29936255, 30072579, 30692096, 35255903, 39742833
Pterygium	Associate	27834959
Pulmonary Disease Chronic Obstructive	Associate	26316738, 30072506, 37972068, 38059012
Pyruvate Carboxylase Deficiency Disease	Associate	26505547, 28970292, 32385139
Rectal Neoplasms	Associate	10884918, 12379157, 15534934, 1685441, 17636402, 1854618, 18655729, 19095777, 19571709, 19669908, 19913317, 20383576, 20622004, 20725992, 20959826 View all (40 more)
Rectal Neoplasms	Inhibit	33825830
Recurrence	Associate	22481281, 27911859, 33858364
Renal Insufficiency	Associate	30120912, 33764817
Reproductive Tract Infections	Associate	34102999
Retinal Dysplasia	Associate	10517904, 10522720, 11171833, 11815980, 15083190, 1854618, 23206236, 26910894, 31175866, 34895278, 7835579, 8160776, 8675098, 8679466, 9020477, 9351717 View all (1 more)
Retinoblastoma	Associate	30664191
Rhabdoid Tumor	Associate	34432771
Rhabdomyosarcoma	Associate	10735503, 23578105, 34755412, 39368853
Rhabdomyosarcoma Embryonal	Associate	27589201, 33846547, 34755412
Rufous oculocutaneous albinism	Associate	23917487
Salivary Duct Calculi	Associate	26289340
Salivary Gland Neoplasms	Associate	19547661
Sarcoma	Associate	10735503, 29881993, 32290854, 32520634, 32561656, 37609465
Sarcoma Ewing	Associate	25119929, 27077911, 35486030
Sarcoma Myeloid	Associate	34465355
Sarcoma Synovial	Associate	26415226
Schistosomiasis	Associate	11592777
Schizotypal Personality Disorder	Associate	21136228
Schmid Fraccaro syndrome	Associate	23112547
Scorpion Stings	Associate	21730978
Sebaceous gland hyperplasia familial presenile	Associate	26804118
Sebaceous Gland Neoplasms	Associate	26804118
Seizures	Associate	36973520
Seminoma	Associate	25597018, 28426398, 29898407, 31070303, 7535083, 8143614
Sezary Syndrome	Associate	21209378
Sick Sinus Syndrome	Associate	33963001
Sigmoid Neoplasms	Associate	20979647, 32594310
Simosa cranio facial syndrome	Associate	30891959
Sinonasal undifferentiated carcinoma	Associate	23633104, 33203919
Skin Diseases	Associate	20550522, 26521233, 27938998, 28434888, 29381910, 34649968
Sleep Disorders Circadian Rhythm	Associate	38432028
Small Cell Lung Carcinoma	Associate	21718596, 24828667, 24978188, 27079212, 30048458, 34121659, 34380837
Smoke Inhalation Injury	Associate	17198183, 23932486, 26923333, 31436246, 37011378, 8143615
Smoldering Multiple Myeloma	Associate	32442065, 33436579
Solitary Pulmonary Nodule	Associate	19844187, 30485130
Spinal Cord Diseases	Associate	36751054
Spinal Cord Injuries	Associate	31444279
Spinocerebellar Degenerations	Associate	23469219, 24061861, 29518181
Splenomegaly	Associate	21063026, 33472608
Squamous Cell Carcinoma of Head and Neck	Associate	19380522, 20813562, 21631644, 22994622, 24351425, 2502519, 25056374, 25081901, 26883054, 31960612, 32296588, 34828284, 36012290, 7599040
Status Asthmaticus	Associate	31289310
Stomach Diseases	Associate	1902452, 25867268, 36853786, 8440743
Stomach Neoplasms	Associate	1685441, 16997920, 1902452, 19545448, 20658094, 21080251, 22159814, 23196062, 23511561, 23667495, 23729275, 23880861, 24774510, 24861525, 25372287 View all (26 more)
Struma Ovarii	Associate	22682753
Sturge Weber Syndrome	Associate	34607843
Sveinsson Chorioretinal Atrophy	Associate	24149137
Tachycardia Atrioventricular Nodal Reentry	Associate	23741067
Tarlov Cysts	Associate	34769348, 36418844, 37557892, 37761948
Teratoma	Associate	25297496, 31695154, 37160315
Teratoma Ovarian	Associate	22682753, 33670958
Tertiary Lymphoid Structures	Associate	19515263, 24139215, 31264684, 32277629, 35173719
Testicular Germ Cell Tumor	Associate	16354586, 28426398, 7535083
Testicular Neoplasms	Associate	1829952, 31492770, 8143614
Thrombocytopenia	Associate	33472608
Thromboembolism	Associate	37771286
Thrombophilia	Associate	25809746, 37771286
Thrombosis	Associate	38069251
Thymic epithelial tumor	Associate	29736783
Thymoma	Associate	19861435
Thymus Neoplasms	Associate	34583424
Thyroid cancer medullary	Associate	18383861, 22865907, 23264394
Thyroid Cancer Papillary	Associate	17660800, 18383861, 21190444, 22682753, 24798740, 27127178, 27873522, 29214440, 30358208, 31085763, 32315324, 33390813, 33821390, 34104084, 34628367, 37307878 View all (1 more)
Thyroid Carcinoma Anaplastic	Associate	28489587
Thyroid Neoplasms	Associate	19652218, 24798740, 26259532, 26695504, 27127178, 27717198, 33821390, 34171097, 38277563, 40104288
Thyroid Nodule	Associate	20087229, 21190444, 25132659, 25648502, 26166089, 26621130, 29247171, 31295281, 33860907, 34318534, 37744220, 38407967
Thyroiditis	Associate	22732473, 31295281
Triple Negative Breast Neoplasms	Associate	21435948, 24205362, 30607635, 34944094
Tuberculosis Multidrug Resistant	Associate	34065402
Tuberous Sclerosis	Associate	20633017
Tubular Sweat Gland Adenomas	Associate	39377508
Turcot syndrome	Associate	23211288, 23511561, 24800948, 25663779, 26042813, 30578081, 32620917, 35778698, 36937571, 38229035, 8394730
Turner Syndrome	Associate	23761422
Ulcer	Associate	23999847
Unilateral Breast Neoplasms	Associate	26739511, 27509333
Unilateral Breast Neoplasms	Stimulate	31848314
Uniparental Disomy	Associate	35255903
Urachal adenocarcinoma	Associate	35731998, 36670542
Urachal cancer	Associate	26925973, 27283768, 35467000
Urethral Neoplasms	Associate	23724131, 25097040, 26039708, 35731998, 36812689
Urinary Bladder Neoplasms	Associate	20845292, 21072204, 2108944, 21113138, 22820081, 29517678, 33282949
Uterine Cervical Diseases	Associate	29185262
Uterine Cervical Dysplasia	Associate	15864214, 19208745, 20848283, 23828315, 28188630, 29658583, 39684873
Uterine Cervical Neoplasms	Associate	21330833, 24390348, 25669975, 26155992, 26197069, 26252302, 28112728, 29185262, 33127935, 33736612, 35008475
Uterine Diseases	Associate	14584071, 24186144, 25361550, 31638232, 35051988
Uveal melanoma	Associate	30571927, 31736361
Vaginal Neoplasms	Associate	34102999
Vascular Diseases	Associate	28371260
Venous Thromboembolism	Associate	25809746, 29743116, 38069251
Venous Thrombosis	Associate	25809746
Vision Disorders	Associate	29948256
Vulvar Lichen Sclerosus	Associate	17554370
Vulvar Neoplasms	Associate	34454393
Weight Gain	Associate	19826477
Weight Loss	Associate	27485414
Wilms Tumor	Associate	30860980, 36455140

KRAS (KRAS proto-oncogene, GTPase)