Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	384
Gene name Gene Name - the full gene name approved by the HGNC.	Arginase 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	ARG2
Synonyms (NCBI Gene) Gene synonyms aliases	-
Chromosome Chromosome number	14
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	14q24.1
Summary Summary of gene provided in NCBI Entrez Gene.	Arginase catalyzes the hydrolysis of arginine to ornithine and urea. At least two isoforms of mammalian arginase exists (types I and II) which differ in their tissue distribution, subcellular localization, immunologic crossreactivity and physiologic func

Show/Hide all(115)

miRTarBase ID	miRNA	Experiments	Reference
MIRT032015	hsa-miR-16-5p	Microarray	21199864
MIRT279714	hsa-let-7a-5p	Flow, Luciferase reporter assay, qRT-PCR, Western blot	26989813
MIRT279714	hsa-let-7a-5p	Flow, Luciferase reporter assay, qRT-PCR, Western blot	26989813
MIRT793393	hsa-miR-759	CLIP-seq
MIRT2173978	hsa-miR-186	CLIP-seq
MIRT2173979	hsa-miR-188-5p	CLIP-seq
MIRT2173980	hsa-miR-2277-3p	CLIP-seq
MIRT2173981	hsa-miR-3133	CLIP-seq
MIRT2173982	hsa-miR-4744	CLIP-seq
MIRT2173983	hsa-miR-542-3p	CLIP-seq
MIRT2443867	hsa-miR-1252	CLIP-seq
MIRT2443868	hsa-miR-1321	CLIP-seq
MIRT2443869	hsa-miR-1912	CLIP-seq
MIRT2443870	hsa-miR-3120-3p	CLIP-seq
MIRT2443871	hsa-miR-3611	CLIP-seq
MIRT2443872	hsa-miR-3651	CLIP-seq
MIRT2443873	hsa-miR-3689a-3p	CLIP-seq
MIRT2443874	hsa-miR-3689c	CLIP-seq
MIRT2443875	hsa-miR-4419a	CLIP-seq
MIRT2443876	hsa-miR-4510	CLIP-seq
MIRT2443877	hsa-miR-4645-3p	CLIP-seq
MIRT2443878	hsa-miR-4648	CLIP-seq
MIRT2443879	hsa-miR-4654	CLIP-seq
MIRT2443880	hsa-miR-4676-5p	CLIP-seq
MIRT2443881	hsa-miR-4728-5p	CLIP-seq
MIRT2443882	hsa-miR-4739	CLIP-seq
MIRT2443883	hsa-miR-4755-3p	CLIP-seq
MIRT2443884	hsa-miR-4756-5p	CLIP-seq
MIRT2443885	hsa-miR-4769-5p	CLIP-seq
MIRT2443886	hsa-miR-4779	CLIP-seq
MIRT2443887	hsa-miR-548aa	CLIP-seq
MIRT2443888	hsa-miR-548ac	CLIP-seq
MIRT2443889	hsa-miR-548d-3p	CLIP-seq
MIRT2443890	hsa-miR-548z	CLIP-seq
MIRT2443891	hsa-miR-575	CLIP-seq
MIRT2443892	hsa-miR-664	CLIP-seq
MIRT2443893	hsa-miR-765	CLIP-seq
MIRT2443868	hsa-miR-1321	CLIP-seq
MIRT2443872	hsa-miR-3651	CLIP-seq
MIRT2443873	hsa-miR-3689a-3p	CLIP-seq
MIRT2443874	hsa-miR-3689c	CLIP-seq
MIRT2443875	hsa-miR-4419a	CLIP-seq
MIRT2443876	hsa-miR-4510	CLIP-seq
MIRT2443877	hsa-miR-4645-3p	CLIP-seq
MIRT2443878	hsa-miR-4648	CLIP-seq
MIRT2443879	hsa-miR-4654	CLIP-seq
MIRT2443880	hsa-miR-4676-5p	CLIP-seq
MIRT2443881	hsa-miR-4728-5p	CLIP-seq
MIRT2443882	hsa-miR-4739	CLIP-seq
MIRT2443883	hsa-miR-4755-3p	CLIP-seq
MIRT2443884	hsa-miR-4756-5p	CLIP-seq
MIRT2443885	hsa-miR-4769-5p	CLIP-seq
MIRT2443886	hsa-miR-4779	CLIP-seq
MIRT2443887	hsa-miR-548aa	CLIP-seq
MIRT2443888	hsa-miR-548ac	CLIP-seq
MIRT2443889	hsa-miR-548d-3p	CLIP-seq
MIRT2443890	hsa-miR-548z	CLIP-seq
MIRT2443891	hsa-miR-575	CLIP-seq
MIRT2443893	hsa-miR-765	CLIP-seq
MIRT2443867	hsa-miR-1252	CLIP-seq
MIRT2443868	hsa-miR-1321	CLIP-seq
MIRT2443870	hsa-miR-3120-3p	CLIP-seq
MIRT2443871	hsa-miR-3611	CLIP-seq
MIRT2443872	hsa-miR-3651	CLIP-seq
MIRT2443873	hsa-miR-3689a-3p	CLIP-seq
MIRT2443874	hsa-miR-3689c	CLIP-seq
MIRT2443875	hsa-miR-4419a	CLIP-seq
MIRT2443876	hsa-miR-4510	CLIP-seq
MIRT2443877	hsa-miR-4645-3p	CLIP-seq
MIRT2443878	hsa-miR-4648	CLIP-seq
MIRT2443879	hsa-miR-4654	CLIP-seq
MIRT2443880	hsa-miR-4676-5p	CLIP-seq
MIRT2443881	hsa-miR-4728-5p	CLIP-seq
MIRT2443882	hsa-miR-4739	CLIP-seq
MIRT2443883	hsa-miR-4755-3p	CLIP-seq
MIRT2443884	hsa-miR-4756-5p	CLIP-seq
MIRT2443885	hsa-miR-4769-5p	CLIP-seq
MIRT2443886	hsa-miR-4779	CLIP-seq
MIRT2443887	hsa-miR-548aa	CLIP-seq
MIRT2443888	hsa-miR-548ac	CLIP-seq
MIRT2477590	hsa-miR-548ag	CLIP-seq
MIRT2477591	hsa-miR-548ai	CLIP-seq
MIRT2443889	hsa-miR-548d-3p	CLIP-seq
MIRT2443890	hsa-miR-548z	CLIP-seq
MIRT2443891	hsa-miR-575	CLIP-seq
MIRT2477592	hsa-miR-617	CLIP-seq
MIRT2443893	hsa-miR-765	CLIP-seq
MIRT2443867	hsa-miR-1252	CLIP-seq
MIRT2443868	hsa-miR-1321	CLIP-seq
MIRT2443870	hsa-miR-3120-3p	CLIP-seq
MIRT2443871	hsa-miR-3611	CLIP-seq
MIRT2443872	hsa-miR-3651	CLIP-seq
MIRT2443873	hsa-miR-3689a-3p	CLIP-seq
MIRT2443874	hsa-miR-3689c	CLIP-seq
MIRT2443875	hsa-miR-4419a	CLIP-seq
MIRT2443876	hsa-miR-4510	CLIP-seq
MIRT2443877	hsa-miR-4645-3p	CLIP-seq
MIRT2443878	hsa-miR-4648	CLIP-seq
MIRT2443879	hsa-miR-4654	CLIP-seq
MIRT2443880	hsa-miR-4676-5p	CLIP-seq
MIRT2443881	hsa-miR-4728-5p	CLIP-seq
MIRT2443882	hsa-miR-4739	CLIP-seq
MIRT2443883	hsa-miR-4755-3p	CLIP-seq
MIRT2443884	hsa-miR-4756-5p	CLIP-seq
MIRT2443885	hsa-miR-4769-5p	CLIP-seq
MIRT2443886	hsa-miR-4779	CLIP-seq
MIRT2443887	hsa-miR-548aa	CLIP-seq
MIRT2443888	hsa-miR-548ac	CLIP-seq
MIRT2477590	hsa-miR-548ag	CLIP-seq
MIRT2477591	hsa-miR-548ai	CLIP-seq
MIRT2443889	hsa-miR-548d-3p	CLIP-seq
MIRT2443890	hsa-miR-548z	CLIP-seq
MIRT2443891	hsa-miR-575	CLIP-seq
MIRT2477592	hsa-miR-617	CLIP-seq
MIRT2443893	hsa-miR-765	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
AR	Activation	20711410

Show/Hide all(39)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000050	Process	Urea cycle	IBA
GO:0000050	Process	Urea cycle	IEA
GO:0001657	Process	Ureteric bud development	IEA
GO:0002250	Process	Adaptive immune response	IEA
GO:0002376	Process	Immune system process	IEA
GO:0002829	Process	Negative regulation of type 2 immune response	IEA
GO:0004053	Function	Arginase activity	IBA
GO:0004053	Function	Arginase activity	IEA
GO:0004053	Function	Arginase activity	IMP	16128822
GO:0004053	Function	Arginase activity	TAS	9144563
GO:0005515	Function	Protein binding	IPI	32814053
GO:0005737	Component	Cytoplasm	IBA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IBA
GO:0005739	Component	Mitochondrion	IEA
GO:0005739	Component	Mitochondrion	TAS	8898077
GO:0005759	Component	Mitochondrial matrix	TAS
GO:0006525	Process	Arginine metabolic process	IEA
GO:0006809	Process	Nitric oxide biosynthetic process	TAS	8898077
GO:0006941	Process	Striated muscle contraction	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0016813	Function	Hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amidines	IEA
GO:0030145	Function	Manganese ion binding	IBA
GO:0032651	Process	Regulation of interleukin-1 beta production	IEA
GO:0032696	Process	Negative regulation of interleukin-13 production	IEA
GO:0032700	Process	Negative regulation of interleukin-17 production	IEA
GO:0032720	Process	Negative regulation of tumor necrosis factor production	IEA
GO:0032720	Process	Negative regulation of tumor necrosis factor production	IMP	28614294
GO:0045087	Process	Innate immune response	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0051241	Process	Negative regulation of multicellular organismal process	IEA
GO:0071641	Process	Negative regulation of macrophage inflammatory protein 1 alpha production	IEA
GO:0071644	Process	Negative regulation of chemokine (C-C motif) ligand 4 production	IEA
GO:0071650	Process	Negative regulation of chemokine (C-C motif) ligand 5 production	IEA
GO:1900425	Process	Negative regulation of defense response to bacterium	IEA
GO:1903426	Process	Regulation of reactive oxygen species biosynthetic process	IEA
GO:1905403	Process	Negative regulation of activated CD8-positive, alpha-beta T cell apoptotic process	IEA
GO:2000562	Process	Negative regulation of CD4-positive, alpha-beta T cell proliferation	IEA
GO:2000774	Process	Positive regulation of cellular senescence	IDA	22928666

MIM	HGNC	e!Ensembl
107830	664	ENSG00000081181

Protein

UniProt ID

P78540

Protein name

Arginase-2, mitochondrial (EC 3.5.3.1) (Arginase II) (Kidney-type arginase) (Non-hepatic arginase) (Type II arginase)

Protein function

May play a role in the regulation of extra-urea cycle arginine metabolism and also in down-regulation of nitric oxide synthesis. Extrahepatic arginase functions to regulate L-arginine bioavailability to nitric oxid synthase (NOS). Arginine metab

PDB

1PQ3 , 4HZE , 4I06 , 4IE2 , 4IE3 , 4IXU , 4IXV , 6Q37 , 6Q39 , 6SS2 , 6SS4 , 6SS6 , 8RFA , 8RG6 , 8RGF , 8RGU , 8RIM , 9FRV

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00491	Arginase	24 → 324	Arginase family	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed most strongly in kidney and prostate, much less strongly in the brain, skeletal muscle, placenta, lung, mammary gland, macrophage, uterus, testis and gut, but apparently not in the liver, heart and pancreas. Expressed in acti

Sequence

MSLRGSLSRLLQTRVHSILKKSVHSVAVIGAPFSQGQKRKGVEHGPAAIREAGLMKRLSS
LGCHLKDFGDLSFTPVPKDDLYNNLIVNPRSVGLANQELAEVVSRAVSDGYSCVTLGGDH
SLAIGTISGHARHCPDLCVVWVDAHADINTPLTTSSGNLHGQPVSFLLRELQDKVPQLPG
FSWIKPCISSASIVYIGLRDVDPPEHFILKNYDIQYFSMRDIDRLGIQKVMERTFDLLIG
KRQRPIHLSFDIDAFDPTLAPATGTPVVGGLTYREGMYIAEEIHNTGLLSALDLVEVNPQ
LATSEEEAKTTANLAVDVIASSFGQTREGGHIVYDQLPTPSSPDESENQARVRI

Sequence length

354

Interactions

View interactions

	KEGG		Reactome
	Arginine biosynthesis Arginine and proline metabolism Metabolic pathways Biosynthesis of amino acids Efferocytosis Amoebiasis		Urea cycle

ARG2 (arginase 2)