Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
3837
Gene name Gene Name - the full gene name approved by the HGNC.
Karyopherin subunit beta 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
KPNB1
Synonyms (NCBI Gene) Gene synonyms aliases
IMB1, IPO1, IPOB, Impnb, NTF97
Chromosome Chromosome number
17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
17q21.32
Summary Summary of gene provided in NCBI Entrez Gene.
Nucleocytoplasmic transport, a signal- and energy-dependent process, takes place through nuclear pore complexes embedded in the nuclear envelope. The import of proteins containing a nuclear localization signal (NLS) requires the NLS import receptor, a het
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT049219 hsa-miR-92a-3p CLASH 23622248
MIRT047765 hsa-miR-7-5p CLASH 23622248
MIRT047236 hsa-miR-181b-5p CLASH 23622248
MIRT046618 hsa-miR-222-3p CLASH 23622248
MIRT046618 hsa-miR-222-3p CLASH 23622248
Transcription factors
Transcription factor Regulation Reference
EZH2 Activation 24132643
SRF Unknown 21131446
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0003723 Function RNA binding HDA 22681889
GO:0005515 Function Protein binding IPI 9405152, 10353244, 10523667, 11024021, 11311162, 11971900, 12372823, 15282309, 15494309, 15507604, 15870280, 16314522, 17209048, 17596301, 19668212, 19680228, 20701745, 20818336, 21072240, 21858095, 22084111, 22500989, 24169621, 26195665, 26496610, 28514442, 29734393, 30833792, 3396
GO:0005576 Component Extracellular region TAS
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
602738 6400 ENSG00000108424
Protein
UniProt ID Q14974
Protein name Importin subunit beta-1 (Importin-90) (Karyopherin subunit beta-1) (Nuclear factor p97) (Pore targeting complex 97 kDa subunit) (PTAC97)
Protein function Functions in nuclear protein import, either in association with an adapter protein, like an importin-alpha subunit, which binds to nuclear localization signals (NLS) in cargo substrates, or by acting as autonomous nuclear transport receptor (Pub
PDB 1F59 , 1IBR , 1M5N , 1O6O , 1O6P , 1QGK , 1QGR , 2P8Q , 2Q5D , 2QNA , 3LWW , 3W5K , 6N88 , 6N89 , 8GCN
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF03810 IBN_N 21 101 Importin-beta N-terminal domain Family
PF00514 Arm 399 437 Armadillo/beta-catenin-like repeat Repeat
Sequence
MELITILEKTVSPDRLELEAAQKFLERAAVENLPTFLVELSRVLANPGNSQVARVAAGLQ
IKNSLTSKDPDIKAQYQQRWLAIDANARREVKNYVLQTLGT
ETYRPSSASQCVAGIACAE
IPVNQWPELIPQLVANVTNPNSTEHMKESTLEAIGYICQDIDPEQLQDKSNEILTAIIQG
MRKEEPSNNVKLAATNALLNSLEFTKANFDKESERHFIMQVVCEATQCPDTRVRVAALQN
LVKIMSLYYQYMETYMGPALFAITIEAMKSDIDEVALQGIEFWSNVCDEEMDLAIEASEA
AEQGRPPEHTSKFYAKGALQYLVPILTQTLTKQDENDDDDDWNPCKAAGVCLMLLATCCE
DDIVPHVLPFIKEHIKNPDWRYRDAAVMAFGCILEGPEPSQLKPLVIQAMPTLIELMKDP
SVVVRDTAAWTVGRICE
LLPEAAINDVYLAPLLQCLIEGLSAEPRVASNVCWAFSSLAEA
AYEAADVADDQEEPATYCLSSSFELIVQKLLETTDRPDGHQNNLRSSAYESLMEIVKNSA
KDCYPAVQKTTLVIMERLQQVLQMESHIQSTSDRIQFNDLQSLLCATLQNVLRKVQHQDA
LQISDVVMASLLRMFQSTAGSGGVQEDALMAVSTLVEVLGGEFLKYMEAFKPFLGIGLKN
YAEYQVCLAAVGLVGDLCRALQSNIIPFCDEVMQLLLENLGNENVHRSVKPQILSVFGDI
ALAIGGEFKKYLEVVLNTLQQASQAQVDKSDYDMVDYLNELRESCLEAYTGIVQGLKGDQ
ENVHPDVMLVQPRVEFILSFIDHIAGDEDHTDGVVACAAGLIGDLCTAFGKDVLKLVEAR
PMIHELLTEGRRSKTNKAKTLATWATKELRKLKNQA
Sequence length 876
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Nucleocytoplasmic transport
Chemical carcinogenesis - receptor activation
  ISG15 antiviral mechanism
Apoptosis induced DNA fragmentation
Regulation of cholesterol biosynthesis by SREBP (SREBF)
Transport of Ribonucleoproteins into the Host Nucleus
NS1 Mediated Effects on Host Pathways
Nuclear import of Rev protein
Initiation of Nuclear Envelope (NE) Reformation
Neutrophil degranulation
Inhibition of nitric oxide production
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Ankylosing Spondylitis Ankylosing spondylitis N/A N/A GWAS
Multiple Sclerosis Multiple sclerosis N/A N/A GWAS
Ovarian cancer Epithelial ovarian cancer Taken together, these results suggest that KPNB1 inhibition exerts its antitumor effect, in part, by inducing apoptosis and cell cycle arrest in human EOC. 28811376 CBGDA
Prostate cancer Prostate cancer N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Breast Neoplasms Associate 29251332
Carcinogenesis Associate 35902727
Carcinoma Hepatocellular Associate 38410971
Carcinoma Non Small Cell Lung Associate 35763629, 36551208
Carcinoma Ovarian Epithelial Associate 28811376
Carcinoma Pancreatic Ductal Associate 35864095
Disease Resistance Associate 26498772
Drug Resistant Epilepsy Stimulate 26498772
Glioblastoma Associate 29520102, 38254206
Head and Neck Neoplasms Associate 26242264