KIF25 (kinesin family member 25)

Gene

• Entrez ID: 3834
• Gene name: Kinesin family member 25
• Gene symbol: KIF25
• Synonyms (NCBI Gene): KNSL3
• Chromosome: 6
• Chromosome location: 6q27
• Summary: The protein encoded by this gene is a member of the kinesin-like protein family. Protein family members are microtubule-dependent molecular motors that transport organelles within cells and move chromosomes during cell division. However, the particular fu

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1094387	hsa-miR-142-5p	CLIP-seq
MIRT1094388	hsa-miR-340	CLIP-seq
MIRT1094389	hsa-miR-4422	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000070	Process	Mitotic sister chromatid segregation	TAS	9925916
GO:0000166	Function	Nucleotide binding	IEA
GO:0003777	Function	Microtubule motor activity	IBA
GO:0003777	Function	Microtubule motor activity	IEA
GO:0005524	Function	ATP binding	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IEA
GO:0005813	Component	Centrosome	ISS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005871	Component	Kinesin complex	IBA
GO:0005871	Component	Kinesin complex	TAS	9925916
GO:0005874	Component	Microtubule	IBA
GO:0005874	Component	Microtubule	IEA
GO:0006996	Process	Organelle organization	TAS	9925916
GO:0007018	Process	Microtubule-based movement	IBA
GO:0007018	Process	Microtubule-based movement	IEA
GO:0008017	Function	Microtubule binding	IBA
GO:0008017	Function	Microtubule binding	IEA
GO:0008569	Function	Minus-end-directed microtubule motor activity	ISS
GO:0010507	Process	Negative regulation of autophagy	IMP	22354037
GO:0016887	Function	ATP hydrolysis activity	IBA
GO:0046603	Process	Negative regulation of mitotic centrosome separation	IDA	28263957
GO:0051289	Process	Protein homotetramerization	ISS
GO:0051294	Process	Establishment of spindle orientation	IDA	28263957
GO:0051647	Process	Nucleus localization	IDA	28263957

Other IDs

• MIM: 603815
• HGNC: 6390
• e!Ensembl: ENSG00000125337

Protein

• UniProt ID: Q9UIL4
• Protein name: Kinesin-like protein KIF25 (Kinesin-like protein 3)
• Protein function: Minus-end microtubule-dependent motor protein (By similarity). Acts as a negative regulator of centrosome separation required to prevent premature centrosome separation during interphase (PubMed:28263957). Required to maintain a centered nucleus
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00225	Kinesin	27 → 363	Kinesin motor domain	Domain

• Sequence:

  MTWTSGQLQREKQARPGSGAVLAFPDDKDLRVYGPAESQSAVFGDVCPLLTSLLDGYNVC
  VMAYGQTGSGKSYTMLGRHSDDGPVLPLDPQSDLGIIPRVAEELFRLILENTSRSPKVEV
  SIVEVYNNDIFDLLAKDSIAAVSGVKREVVTAKDGRTEVALLASEAVGSASKLMELVHGG
  LQLRAKHPTLVHADSSRSHLIITVTLTTASCSDSTADQACSATLPREQTEAGRAGRSRRA
  SQGALAPQLVPGNPAGHAEQVQARLQLVDSAGSECVGVSGVTGLALREMACISRSLAALA
  GVLGALLEHRGHAPYRNSRLTHLLQDCLGGDAKLLVILCISPSQRHLAQTLQGLGFGIRA
  RQVQRGPARKKPPSSQTEGKRRPD

• Sequence length: 384

Pathways

KEGG:

Motor proteins

Reactome:

COPI-dependent Golgi-to-ER retrograde traffic
Kinesins