Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	3832
Gene name	Kinesin family member 11
Gene symbol	KIF11
Synonyms (NCBI Gene)	EG5HKSPKNSL1MCLMRTRIP5
Chromosome	10
Chromosome location	10q23.33
Summary	This gene encodes a motor protein that belongs to the kinesin-like protein family. Members of this protein family are known to be involved in various kinds of spindle dynamics. The function of this gene product includes chromosome positioning, centrosome

Show/Hide all (47)

SNP ID	Visualize variation	Clinical significance	Consequence
rs387906641	C>T	Pathogenic	Coding sequence variant, stop gained
rs387906642	C>T	Uncertain-significance, pathogenic	Coding sequence variant, missense variant
rs387906643	C>G	Pathogenic	Coding sequence variant, missense variant
rs730882061	CT>-	Pathogenic	Coding sequence variant, frameshift variant
rs730882062	A>-	Pathogenic	Coding sequence variant, frameshift variant
rs730882063	T>C	Pathogenic	Splice donor variant
rs730882121	TT>-	Pathogenic	Coding sequence variant, frameshift variant
rs730882122	G>A,T	Pathogenic	Splice acceptor variant
rs786205900	G>T	Pathogenic	Stop gained, coding sequence variant
rs797045649	CAT>AA	Pathogenic	Frameshift variant, 5 prime UTR variant, initiator codon variant
rs797045650	A>T	Pathogenic	Stop gained, coding sequence variant
rs797045651	TTTCTAGTCGTTCC>-	Pathogenic	Coding sequence variant, intron variant, splice acceptor variant
rs886041462	G>A	Pathogenic	Splice donor variant
rs886041477	TGC>AG	Pathogenic	Coding sequence variant, frameshift variant
rs1057516208	C>T	Pathogenic	Stop gained, coding sequence variant
rs1057518144	->T	Pathogenic	Frameshift variant, coding sequence variant
rs1057518980	ATAAATCAAT>-	Likely-pathogenic	Frameshift variant, coding sequence variant
rs1057519141	A>-	Likely-pathogenic	Intron variant
rs1057524736	G>A	Pathogenic	Splice donor variant
rs1064795570	A>T	Likely-pathogenic	Stop gained, coding sequence variant
rs1064796738	C>T	Pathogenic	Stop gained, coding sequence variant
rs1227480400	C>G,T	Pathogenic	Missense variant, coding sequence variant, stop gained
rs1554858130	T>C	Pathogenic	Initiator codon variant, missense variant
rs1554859309	C>-	Pathogenic	Frameshift variant, coding sequence variant
rs1554859344	G>T	Pathogenic	Stop gained, coding sequence variant
rs1554859399	A>-	Likely-pathogenic	Frameshift variant, coding sequence variant
rs1554859966	C>T	Pathogenic	Stop gained, coding sequence variant
rs1554860819	->T	Likely-pathogenic	Frameshift variant, coding sequence variant
rs1554861545	GAG>-	Pathogenic, likely-pathogenic	Inframe deletion, coding sequence variant
rs1554862197	C>-	Likely-pathogenic	Frameshift variant, coding sequence variant
rs1554862218	G>T	Pathogenic	Splice donor variant
rs1554862423	GAAT>-	Likely-pathogenic	Frameshift variant, coding sequence variant
rs1554862427	C>T	Pathogenic	Stop gained, coding sequence variant
rs1554863016	G>A	Pathogenic	Splice acceptor variant
rs1554863044	TGAA>-	Pathogenic	Frameshift variant, coding sequence variant
rs1554863182	CCT>-	Likely-pathogenic	Inframe deletion, coding sequence variant
rs1554863201	G>A	Pathogenic, uncertain-significance	Synonymous variant, coding sequence variant
rs1554863246	->T	Likely-pathogenic	Frameshift variant, coding sequence variant
rs1564713037	T>C	Likely-pathogenic	Missense variant, coding sequence variant
rs1589590737	G>A	Pathogenic	Coding sequence variant, stop gained
rs1589591659	CT>-	Pathogenic	Frameshift variant, coding sequence variant
rs1589595589	->A	Pathogenic	Frameshift variant, coding sequence variant
rs1589600660	G>-	Likely-pathogenic	Frameshift variant, coding sequence variant
rs1589600695	G>A	Likely-pathogenic	Splice donor variant
rs1589604288	A>-	Pathogenic	Frameshift variant, coding sequence variant
rs1589607930	G>-	Pathogenic	Frameshift variant, coding sequence variant
rs1589608594	C>T	Pathogenic	Coding sequence variant, stop gained

291

Show/Hide all (291)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016382	hsa-miR-193b-3p	Microarray	20304954
MIRT019584	hsa-miR-340-5p	Sequencing	20371350
MIRT021126	hsa-miR-186-5p	Sequencing	20371350
MIRT025295	hsa-miR-34a-5p	Proteomics	21566225
MIRT025295	hsa-miR-34a-5p	Proteomics	21566225
MIRT025295	hsa-miR-34a-5p	Proteomics	21566225
MIRT025295	hsa-miR-34a-5p	Proteomics	21566225
MIRT028535	hsa-miR-30a-5p	Proteomics	18668040
MIRT021126	hsa-miR-186-5p	PAR-CLIP	20371350
MIRT057489	hsa-miR-6507-5p	PAR-CLIP	20371350
MIRT556789	hsa-miR-96-3p	PAR-CLIP	20371350
MIRT057488	hsa-miR-4495	PAR-CLIP	20371350
MIRT028535	hsa-miR-30a-5p	PAR-CLIP	20371350
MIRT057485	hsa-miR-30b-5p	PAR-CLIP	20371350
MIRT057483	hsa-miR-30c-5p	PAR-CLIP	20371350
MIRT057484	hsa-miR-30d-5p	PAR-CLIP	20371350
MIRT057486	hsa-miR-30e-5p	PAR-CLIP	20371350
MIRT556788	hsa-miR-6516-3p	PAR-CLIP	20371350
MIRT021126	hsa-miR-186-5p	PAR-CLIP	21572407
MIRT057489	hsa-miR-6507-5p	PAR-CLIP	21572407
MIRT556789	hsa-miR-96-3p	PAR-CLIP	21572407
MIRT057488	hsa-miR-4495	PAR-CLIP	21572407
MIRT028535	hsa-miR-30a-5p	PAR-CLIP	21572407
MIRT057485	hsa-miR-30b-5p	PAR-CLIP	21572407
MIRT057483	hsa-miR-30c-5p	PAR-CLIP	21572407
MIRT057484	hsa-miR-30d-5p	PAR-CLIP	21572407
MIRT057486	hsa-miR-30e-5p	PAR-CLIP	21572407
MIRT556788	hsa-miR-6516-3p	PAR-CLIP	21572407
MIRT021126	hsa-miR-186-5p	PAR-CLIP	20371350
MIRT057489	hsa-miR-6507-5p	PAR-CLIP	20371350
MIRT556789	hsa-miR-96-3p	PAR-CLIP	20371350
MIRT057488	hsa-miR-4495	PAR-CLIP	20371350
MIRT028535	hsa-miR-30a-5p	PAR-CLIP	20371350
MIRT057485	hsa-miR-30b-5p	PAR-CLIP	20371350
MIRT057483	hsa-miR-30c-5p	PAR-CLIP	20371350
MIRT057484	hsa-miR-30d-5p	PAR-CLIP	20371350
MIRT057486	hsa-miR-30e-5p	PAR-CLIP	20371350
MIRT556788	hsa-miR-6516-3p	PAR-CLIP	20371350
MIRT021126	hsa-miR-186-5p	PAR-CLIP	21572407
MIRT057489	hsa-miR-6507-5p	PAR-CLIP	21572407
MIRT556789	hsa-miR-96-3p	PAR-CLIP	21572407
MIRT057488	hsa-miR-4495	PAR-CLIP	21572407
MIRT028535	hsa-miR-30a-5p	PAR-CLIP	21572407
MIRT057485	hsa-miR-30b-5p	PAR-CLIP	21572407
MIRT057483	hsa-miR-30c-5p	PAR-CLIP	21572407
MIRT057484	hsa-miR-30d-5p	PAR-CLIP	21572407
MIRT057486	hsa-miR-30e-5p	PAR-CLIP	21572407
MIRT556788	hsa-miR-6516-3p	PAR-CLIP	21572407
MIRT028535	hsa-miR-30a-5p	Luciferase reporter assayWestern blottingqRT-PCR	35140744
MIRT1093089	hsa-miR-106a	CLIP-seq
MIRT1093090	hsa-miR-106b	CLIP-seq
MIRT1093091	hsa-miR-122	CLIP-seq
MIRT1093092	hsa-miR-1231	CLIP-seq
MIRT1093093	hsa-miR-124	CLIP-seq
MIRT1093094	hsa-miR-1245b-3p	CLIP-seq
MIRT1093095	hsa-miR-1245b-5p	CLIP-seq
MIRT1093096	hsa-miR-1293	CLIP-seq
MIRT1093097	hsa-miR-1295	CLIP-seq
MIRT1093098	hsa-miR-1306	CLIP-seq
MIRT1093099	hsa-miR-150	CLIP-seq
MIRT1093100	hsa-miR-17	CLIP-seq
MIRT1093101	hsa-miR-200b	CLIP-seq
MIRT1093102	hsa-miR-200c	CLIP-seq
MIRT1093103	hsa-miR-203	CLIP-seq
MIRT1093104	hsa-miR-2052	CLIP-seq
MIRT1093105	hsa-miR-20a	CLIP-seq
MIRT1093106	hsa-miR-20b	CLIP-seq
MIRT1093107	hsa-miR-2113	CLIP-seq
MIRT1093108	hsa-miR-23a	CLIP-seq
MIRT1093109	hsa-miR-23b	CLIP-seq
MIRT1093110	hsa-miR-23c	CLIP-seq
MIRT1093111	hsa-miR-296-3p	CLIP-seq
MIRT1093112	hsa-miR-302a	CLIP-seq
MIRT1093113	hsa-miR-302b	CLIP-seq
MIRT1093114	hsa-miR-302c	CLIP-seq
MIRT1093115	hsa-miR-302d	CLIP-seq
MIRT1093116	hsa-miR-302e	CLIP-seq
MIRT1093117	hsa-miR-3064-3p	CLIP-seq
MIRT1093118	hsa-miR-3119	CLIP-seq
MIRT1093119	hsa-miR-3132	CLIP-seq
MIRT1093120	hsa-miR-3142	CLIP-seq
MIRT1093121	hsa-miR-3160-5p	CLIP-seq
MIRT1093122	hsa-miR-3173-3p	CLIP-seq
MIRT1093123	hsa-miR-3180-5p	CLIP-seq
MIRT1093124	hsa-miR-3187-3p	CLIP-seq
MIRT1093125	hsa-miR-3198	CLIP-seq
MIRT1093126	hsa-miR-323-5p	CLIP-seq
MIRT1093127	hsa-miR-3609	CLIP-seq
MIRT1093128	hsa-miR-3611	CLIP-seq
MIRT1093129	hsa-miR-3646	CLIP-seq
MIRT1093130	hsa-miR-3663-5p	CLIP-seq
MIRT1093131	hsa-miR-371-5p	CLIP-seq
MIRT1093132	hsa-miR-371b-5p	CLIP-seq
MIRT1093133	hsa-miR-372	CLIP-seq
MIRT1093134	hsa-miR-373	CLIP-seq
MIRT1093135	hsa-miR-374c	CLIP-seq
MIRT1093136	hsa-miR-3908	CLIP-seq
MIRT1093137	hsa-miR-3935	CLIP-seq
MIRT1093138	hsa-miR-3942-5p	CLIP-seq
MIRT1093139	hsa-miR-4260	CLIP-seq
MIRT1093140	hsa-miR-4265	CLIP-seq
MIRT1093141	hsa-miR-4272	CLIP-seq
MIRT1093142	hsa-miR-4289	CLIP-seq
MIRT1093143	hsa-miR-429	CLIP-seq
MIRT1093144	hsa-miR-4296	CLIP-seq
MIRT1093145	hsa-miR-4309	CLIP-seq
MIRT1093146	hsa-miR-432	CLIP-seq
MIRT1093147	hsa-miR-4322	CLIP-seq
MIRT1093148	hsa-miR-4417	CLIP-seq
MIRT1093149	hsa-miR-4424	CLIP-seq
MIRT1093150	hsa-miR-4435	CLIP-seq
MIRT1093151	hsa-miR-4438	CLIP-seq
MIRT1093152	hsa-miR-4483	CLIP-seq
MIRT1093153	hsa-miR-4506	CLIP-seq
MIRT1093154	hsa-miR-4645-3p	CLIP-seq
MIRT1093155	hsa-miR-4684-5p	CLIP-seq
MIRT1093156	hsa-miR-4698	CLIP-seq
MIRT1093157	hsa-miR-4699-3p	CLIP-seq
MIRT1093158	hsa-miR-4701-5p	CLIP-seq
MIRT1093159	hsa-miR-4703-5p	CLIP-seq
MIRT1093160	hsa-miR-4713-5p	CLIP-seq
MIRT1093161	hsa-miR-4715-3p	CLIP-seq
MIRT1093162	hsa-miR-4724-5p	CLIP-seq
MIRT1093163	hsa-miR-4731-5p	CLIP-seq
MIRT1093164	hsa-miR-4733-5p	CLIP-seq
MIRT1093165	hsa-miR-4755-3p	CLIP-seq
MIRT1093166	hsa-miR-4757-5p	CLIP-seq
MIRT1093167	hsa-miR-4760-5p	CLIP-seq
MIRT1093168	hsa-miR-4766-3p	CLIP-seq
MIRT1093169	hsa-miR-4766-5p	CLIP-seq
MIRT1093170	hsa-miR-4776-3p	CLIP-seq
MIRT1093171	hsa-miR-4779	CLIP-seq
MIRT1093172	hsa-miR-486-3p	CLIP-seq
MIRT1093173	hsa-miR-488	CLIP-seq
MIRT1093174	hsa-miR-494	CLIP-seq
MIRT1093175	hsa-miR-498	CLIP-seq
MIRT1093176	hsa-miR-506	CLIP-seq
MIRT1093177	hsa-miR-5095	CLIP-seq
MIRT1093178	hsa-miR-512-3p	CLIP-seq
MIRT1093179	hsa-miR-518a-5p	CLIP-seq
MIRT1093180	hsa-miR-519d	CLIP-seq
MIRT1093181	hsa-miR-520a-3p	CLIP-seq
MIRT1093182	hsa-miR-520a-5p	CLIP-seq
MIRT1093183	hsa-miR-520b	CLIP-seq
MIRT1093184	hsa-miR-520c-3p	CLIP-seq
MIRT1093185	hsa-miR-520d-3p	CLIP-seq
MIRT1093186	hsa-miR-520d-5p	CLIP-seq
MIRT1093187	hsa-miR-520e	CLIP-seq
MIRT1093188	hsa-miR-520g	CLIP-seq
MIRT1093189	hsa-miR-520h	CLIP-seq
MIRT1093190	hsa-miR-524-5p	CLIP-seq
MIRT1093191	hsa-miR-525-5p	CLIP-seq
MIRT1093192	hsa-miR-527	CLIP-seq
MIRT1093193	hsa-miR-532-3p	CLIP-seq
MIRT1093194	hsa-miR-548ah	CLIP-seq
MIRT1093195	hsa-miR-548an	CLIP-seq
MIRT1093196	hsa-miR-548s	CLIP-seq
MIRT1093197	hsa-miR-574-5p	CLIP-seq
MIRT1093198	hsa-miR-584	CLIP-seq
MIRT1093199	hsa-miR-588	CLIP-seq
MIRT1093200	hsa-miR-605	CLIP-seq
MIRT1093201	hsa-miR-653	CLIP-seq
MIRT1093202	hsa-miR-654-3p	CLIP-seq
MIRT1093203	hsa-miR-655	CLIP-seq
MIRT1093204	hsa-miR-659	CLIP-seq
MIRT1093205	hsa-miR-758	CLIP-seq
MIRT1093206	hsa-miR-93	CLIP-seq
MIRT1093207	hsa-miR-942	CLIP-seq
MIRT2024951	hsa-miR-101	CLIP-seq
MIRT1093089	hsa-miR-106a	CLIP-seq
MIRT1093090	hsa-miR-106b	CLIP-seq
MIRT2024952	hsa-miR-1202	CLIP-seq
MIRT2024953	hsa-miR-1278	CLIP-seq
MIRT1093096	hsa-miR-1293	CLIP-seq
MIRT2024954	hsa-miR-1297	CLIP-seq
MIRT2024955	hsa-miR-1343	CLIP-seq
MIRT2024956	hsa-miR-144	CLIP-seq
MIRT1093099	hsa-miR-150	CLIP-seq
MIRT1093100	hsa-miR-17	CLIP-seq
MIRT1093104	hsa-miR-2052	CLIP-seq
MIRT1093105	hsa-miR-20a	CLIP-seq
MIRT1093106	hsa-miR-20b	CLIP-seq
MIRT1093107	hsa-miR-2113	CLIP-seq
MIRT2024957	hsa-miR-26a	CLIP-seq
MIRT2024958	hsa-miR-26b	CLIP-seq
MIRT1093112	hsa-miR-302a	CLIP-seq
MIRT1093113	hsa-miR-302b	CLIP-seq
MIRT1093114	hsa-miR-302c	CLIP-seq
MIRT1093115	hsa-miR-302d	CLIP-seq
MIRT1093116	hsa-miR-302e	CLIP-seq
MIRT1093118	hsa-miR-3119	CLIP-seq
MIRT2024959	hsa-miR-3170	CLIP-seq
MIRT1093123	hsa-miR-3180-5p	CLIP-seq
MIRT1093126	hsa-miR-323-5p	CLIP-seq
MIRT1093128	hsa-miR-3611	CLIP-seq
MIRT2024960	hsa-miR-3613-3p	CLIP-seq
MIRT2024961	hsa-miR-3664-5p	CLIP-seq
MIRT1093131	hsa-miR-371-5p	CLIP-seq
MIRT1093133	hsa-miR-372	CLIP-seq
MIRT1093134	hsa-miR-373	CLIP-seq
MIRT2024962	hsa-miR-378g	CLIP-seq
MIRT1093136	hsa-miR-3908	CLIP-seq
MIRT1093138	hsa-miR-3942-5p	CLIP-seq
MIRT2024963	hsa-miR-3972	CLIP-seq
MIRT1093141	hsa-miR-4272	CLIP-seq
MIRT2024964	hsa-miR-4314	CLIP-seq
MIRT1093148	hsa-miR-4417	CLIP-seq
MIRT2024965	hsa-miR-4437	CLIP-seq
MIRT2024966	hsa-miR-4465	CLIP-seq
MIRT1093152	hsa-miR-4483	CLIP-seq
MIRT2024967	hsa-miR-4667-5p	CLIP-seq
MIRT2024968	hsa-miR-4674	CLIP-seq
MIRT2024969	hsa-miR-4680-3p	CLIP-seq
MIRT2024970	hsa-miR-4680-5p	CLIP-seq
MIRT1093156	hsa-miR-4698	CLIP-seq
MIRT2024971	hsa-miR-4700-5p	CLIP-seq
MIRT1093159	hsa-miR-4703-5p	CLIP-seq
MIRT1093160	hsa-miR-4713-5p	CLIP-seq
MIRT1093163	hsa-miR-4731-5p	CLIP-seq
MIRT1093168	hsa-miR-4766-3p	CLIP-seq
MIRT1093174	hsa-miR-494	CLIP-seq
MIRT1093175	hsa-miR-498	CLIP-seq
MIRT1093178	hsa-miR-512-3p	CLIP-seq
MIRT2024972	hsa-miR-516a-3p	CLIP-seq
MIRT1093180	hsa-miR-519d	CLIP-seq
MIRT1093181	hsa-miR-520a-3p	CLIP-seq
MIRT1093182	hsa-miR-520a-5p	CLIP-seq
MIRT1093183	hsa-miR-520b	CLIP-seq
MIRT1093184	hsa-miR-520c-3p	CLIP-seq
MIRT1093185	hsa-miR-520d-3p	CLIP-seq
MIRT1093187	hsa-miR-520e	CLIP-seq
MIRT1093188	hsa-miR-520g	CLIP-seq
MIRT1093189	hsa-miR-520h	CLIP-seq
MIRT1093191	hsa-miR-525-5p	CLIP-seq
MIRT1093193	hsa-miR-532-3p	CLIP-seq
MIRT2024973	hsa-miR-582-5p	CLIP-seq
MIRT1093198	hsa-miR-584	CLIP-seq
MIRT2024974	hsa-miR-637	CLIP-seq
MIRT1093204	hsa-miR-659	CLIP-seq
MIRT1093205	hsa-miR-758	CLIP-seq
MIRT1093206	hsa-miR-93	CLIP-seq
MIRT1093095	hsa-miR-1245b-5p	CLIP-seq
MIRT2256093	hsa-miR-1257	CLIP-seq
MIRT1093097	hsa-miR-1295	CLIP-seq
MIRT2024955	hsa-miR-1343	CLIP-seq
MIRT1093099	hsa-miR-150	CLIP-seq
MIRT1093107	hsa-miR-2113	CLIP-seq
MIRT1093118	hsa-miR-3119	CLIP-seq
MIRT1093120	hsa-miR-3142	CLIP-seq
MIRT1093128	hsa-miR-3611	CLIP-seq
MIRT2024961	hsa-miR-3664-5p	CLIP-seq
MIRT2024962	hsa-miR-378g	CLIP-seq
MIRT1093139	hsa-miR-4260	CLIP-seq
MIRT1093148	hsa-miR-4417	CLIP-seq
MIRT1093149	hsa-miR-4424	CLIP-seq
MIRT2024965	hsa-miR-4437	CLIP-seq
MIRT2024968	hsa-miR-4674	CLIP-seq
MIRT2024970	hsa-miR-4680-5p	CLIP-seq
MIRT1093172	hsa-miR-486-3p	CLIP-seq
MIRT1093177	hsa-miR-5095	CLIP-seq
MIRT1093205	hsa-miR-758	CLIP-seq
MIRT1093091	hsa-miR-122	CLIP-seq
MIRT1093118	hsa-miR-3119	CLIP-seq
MIRT1093148	hsa-miR-4417	CLIP-seq
MIRT1093091	hsa-miR-122	CLIP-seq
MIRT2452563	hsa-miR-1267	CLIP-seq
MIRT2024954	hsa-miR-1297	CLIP-seq
MIRT2024955	hsa-miR-1343	CLIP-seq
MIRT2024957	hsa-miR-26a	CLIP-seq
MIRT2024958	hsa-miR-26b	CLIP-seq
MIRT2452564	hsa-miR-3135b	CLIP-seq
MIRT2452565	hsa-miR-3194-3p	CLIP-seq
MIRT2452566	hsa-miR-3652	CLIP-seq
MIRT2452567	hsa-miR-431	CLIP-seq
MIRT2452568	hsa-miR-4423-5p	CLIP-seq
MIRT2452569	hsa-miR-4430	CLIP-seq
MIRT2024966	hsa-miR-4465	CLIP-seq
MIRT2452570	hsa-miR-4786-5p	CLIP-seq
MIRT2024972	hsa-miR-516a-3p	CLIP-seq
MIRT2452571	hsa-miR-769-5p	CLIP-seq
MIRT2452572	hsa-miR-924	CLIP-seq
MIRT1093091	hsa-miR-122	CLIP-seq
MIRT2452563	hsa-miR-1267	CLIP-seq
MIRT2452564	hsa-miR-3135b	CLIP-seq
MIRT2452565	hsa-miR-3194-3p	CLIP-seq
MIRT2452566	hsa-miR-3652	CLIP-seq
MIRT2557885	hsa-miR-4280	CLIP-seq
MIRT2452567	hsa-miR-431	CLIP-seq
MIRT2452568	hsa-miR-4423-5p	CLIP-seq
MIRT2452569	hsa-miR-4430	CLIP-seq
MIRT2452572	hsa-miR-924	CLIP-seq

Show/Hide all (40)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000278	Process	Mitotic cell cycle	TAS	8548803
GO:0000922	Component	Spindle pole	IDA	14718566
GO:0000922	Component	Spindle pole	IEA
GO:0003777	Function	Microtubule motor activity	IEA
GO:0003777	Function	Microtubule motor activity	TAS	8548803
GO:0005515	Function	Protein binding	IPI	21303978, 28169274
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005819	Component	Spindle	IDA	19001501
GO:0005819	Component	Spindle	TAS	8548803
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005871	Component	Kinesin complex	TAS	8548803
GO:0005874	Component	Microtubule	IDA	21525035
GO:0005874	Component	Microtubule	IEA
GO:0005876	Component	Spindle microtubule	IDA	14718566
GO:0007018	Process	Microtubule-based movement	IEA
GO:0007051	Process	Spindle organization	IMP	14718566
GO:0007052	Process	Mitotic spindle organization	TAS	8548803
GO:0007100	Process	Mitotic centrosome separation	IEA
GO:0008017	Function	Microtubule binding	IEA
GO:0008574	Function	Plus-end-directed microtubule motor activity	IBA
GO:0016020	Component	Membrane	HDA	19946888
GO:0019901	Function	Protein kinase binding	IPI	19001501
GO:0032991	Component	Protein-containing complex	IPI	17707232
GO:0036064	Component	Ciliary basal body	IDA
GO:0046602	Process	Regulation of mitotic centrosome separation	IMP	15843429
GO:0051225	Process	Spindle assembly	IEA
GO:0051225	Process	Spindle assembly	IEA
GO:0051231	Process	Spindle elongation	IBA
GO:0051301	Process	Cell division	IEA
GO:0072686	Component	Mitotic spindle	IBA
GO:0072686	Component	Mitotic spindle	IDA
GO:0090307	Process	Mitotic spindle assembly	IBA
GO:0090307	Process	Mitotic spindle assembly	IDA	19001501
GO:0090307	Process	Mitotic spindle assembly	IMP	15843429
GO:0140014	Process	Mitotic nuclear division	IEA

MIM	HGNC	e!Ensembl
148760	6388	ENSG00000138160

P52732

Protein name

Kinesin-like protein KIF11 (Kinesin-like protein 1) (Kinesin-like spindle protein HKSP) (Kinesin-related motor protein Eg5) (Thyroid receptor-interacting protein 5) (TR-interacting protein 5) (TRIP-5)

Protein function

Motor protein required for establishing a bipolar spindle and thus contributing to chromosome congression during mitosis (PubMed:19001501, PubMed:37728657). Required in non-mitotic cells for transport of secretory proteins from the Golgi complex

PDB

1II6 , 1Q0B , 1X88 , 1YRS , 2FKY , 2FL2 , 2FL6 , 2FME , 2G1Q , 2GM1 , 2IEH , 2PG2 , 2Q2Y , 2Q2Z , 2UYI , 2UYM , 2WOG , 2X2R , 2X7C , 2X7D , 2X7E , 2XAE , 3CJO , 3HQD , 3K3B , 3K5E , 3KEN , 3L9H , 3WPN , 3ZCW , 4A1Z , 4A28 , 4A50 , 4A51 , 4A5Y , 4AP0 , 4AQV , 4AQW , 4AS7 , 4B7B , 4BBG , 4BXN , 4CK5 , 4CK6 , 4CK7 , 4ZCA , 4ZHI , 5JV3 , 5ZO7 , 5ZO8 , 5ZO9

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00225	Kinesin	24 → 359	Kinesin motor domain	Domain
PF13931	Microtub_bind	916 → 1053	Kinesin-associated microtubule-binding	Family

Sequence

MASQPNSSAKKKEEKGKNIQVVVRCRPFNLAERKASAHSIVECDPVRKEVSVRTGGLADK
SSRKTYTFDMVFGASTKQIDVYRSVVCPILDEVIMGYNCTIFAYGQTGTGKTFTMEGERS
PNEEYTWEEDPLAGIIPRTLHQIFEKLTDNGTEFSVKVSLLEIYNEELFDLLNPSSDVSE
RLQMFDDPRNKRGVIIKGLEEITVHNKDEVYQILEKGAAKRTTAATLMNAYSSRSHSVFS
VTIHMKETTIDGEELVKIGKLNLVDLAGSENIGRSGAVDKRAREAGNINQSLLTLGRVIT
ALVERTPHVPYRESKLTRILQDSLGGRTRTSIIATISPASLNLEETLSTLEYAHRAKNIL
NKPEVNQKLTKKALIKEYTEEIERLKRDLAAAREKNGVYISEENFRVMSGKLTVQEEQIV
ELIEKIGAVEEELNRVTELFMDNKNELDQCKSDLQNKTQELETTQKHLQETKLQLVKEEY
ITSALESTEEKLHDAASKLLNTVEETTKDVSGLHSKLDRKKAVDQHNAEAQDIFGKNLNS
LFNNMEELIKDGSSKQKAMLEVHKTLFGNLLSSSVSALDTITTVALGSLTSIPENVSTHV
SQIFNMILKEQSLAAESKTVLQELINVLKTDLLSSLEMILSPTVVSILKINSQLKHIFKT
SLTVADKIEDQKKELDGFLSILCNNLHELQENTICSLVESQKQCGNLTEDLKTIKQTHSQ
ELCKLMNLWTERFCALEEKCENIQKPLSSVQENIQQKSKDIVNKMTFHSQKFCADSDGFS
QELRNFNQEGTKLVEESVKHSDKLNGNLEKISQETEQRCESLNTRTVYFSEQWVSSLNER
EQELHNLLEVVSQCCEASSSDITEKSDGRKAAHEKQHNIFLDQMTIDEDKLIAQNLELNE
TIKIGLTKLNCFLEQDLKLDIPTGTTPQRKSYLYPSTLVRTEPREHLLDQLKRKQPELLM
MLNCSENNKEETIPDVDVEEAVLGQYTEEPLSQEPSVDAGVDCSSIGGVPFFQHKKSHGK
DKENRGINTLERSKVEETTEHLVTKSRLPLRAQINL

Sequence length

1056

Interactions

View interactions

	KEGG		Reactome
	Motor proteins		MHC class II antigen presentation COPI-dependent Golgi-to-ER retrograde traffic Kinesins

230

Show/Hide Causal Diseases (13)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
KIF11-related disorder	Likely pathogenic; Pathogenic	rs2492536774, rs1844462368	RCV003402518 RCV003396636
Lymphedema	Likely pathogenic	rs1057518980	RCV000415366
Malignant tumor of urinary bladder	Pathogenic	rs1554863201	RCV005899877
Microcephaly	Pathogenic; Likely pathogenic	rs1554863201, rs1057518980	RCV001720283 RCV000415366
Microcephaly and chorioretinopathy 1	Pathogenic	rs2492536872	RCV001527631
Microcephaly with or without chorioretinopathy, lymphedema or intellectual disability (MCLID)	Pathogenic	rs730882122	RCV001270814
Microcephaly with or without chorioretinopathy, lymphedema, or intellectual disability	Likely pathogenic; Pathogenic	rs1844845643, rs2135900558, rs2135905068, rs1844462612, rs2135904919, rs2135901156, rs2135923459, rs2135923352, rs2135902435, rs2135923477, rs2135923421, rs2135904871, rs2135925601, rs2492519143, rs2492520861 View all (53 more)	RCV001331253 RCV003314007 RCV003485716 RCV001775280 RCV001823032 RCV001843708 RCV002226859 RCV002250890 RCV002250948 RCV002250971 RCV005869764 RCV002273123 RCV002273127 RCV002284016 RCV002289094 RCV002290242 RCV000161138 RCV000161139 RCV002466878 RCV002468726 RCV002472078 RCV000172876 RCV000172877 RCV000192737 RCV000193017 RCV000193886 RCV002789990 RCV002789991 RCV003226073 RCV003330301 RCV003494070 RCV003494079 RCV003986048 RCV003988698 RCV003988930 RCV004588571 RCV000408821 RCV003225941 RCV000022634 RCV000022635 RCV000022637 RCV000022638 RCV000678377 RCV000501993 RCV000500129 RCV000501841 RCV000503314 RCV000502364 RCV000578314 RCV000544300 RCV001255733 RCV000585854 RCV000825016 RCV001007655 RCV000988434 RCV000995792 RCV001030780 RCV001002700 RCV001198017 RCV001255743 RCV001255789 RCV001255842 RCV001255729 RCV001255840 RCV001255829 RCV001255779 RCV001255834 RCV001261950 RCV001283810
Neurodevelopmental delay	Likely pathogenic; Pathogenic	rs2135905068	RCV002274195
Neurodevelopmental disorder	Likely pathogenic	rs2135904903	RCV002277694
Retinal dysplasia	Likely pathogenic	rs1057518980	RCV000415366
Retinal dystrophy	Likely pathogenic; Pathogenic	rs1227480400, rs1844909478, rs1844615558, rs1844944116	RCV004817776 RCV001075451 RCV001074293 RCV001074664
Retinitis pigmentosa	Pathogenic	rs2135925949	RCV001724869
Syndromic retinitis pigmentosa	Likely pathogenic; Pathogenic	rs1589590737	RCV001003069

Show/Hide Unknown Diseases (22)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Acute myeloid leukemia	Benign; Likely benign	rs7067733, rs12248860, rs75382300, rs75876570, rs148976883	RCV005912975 RCV005918849 RCV005925302 RCV005892317 RCV005906467
Cervical cancer	Benign; Likely benign	rs7067733, rs540078122, rs187038614, rs113197692	RCV005912976 RCV005914743 RCV005916313 RCV005920435
Clear cell carcinoma of kidney	Likely benign	rs148976883	RCV005906469
CTCF-related neurodevelopmental disorder	Conflicting classifications of pathogenicity	rs1589597598	RCV001838339
Decreased total lymphocyte count	Likely benign; Benign	rs147164679, rs200188195	RCV002227522 RCV002227504
Decreased total neutrophil count	Likely benign; Benign	rs147164679, rs200188195	RCV002227522 RCV002227504
Developmental disorder	Uncertain significance	rs2492480944	RCV003127308
Exudative vitreoretinopathy 1	Conflicting classifications of pathogenicity	rs1554861545	RCV003987579
Familial cancer of breast	Uncertain significance; Likely benign	rs778431479, rs187038614	RCV005911088 RCV005916311
Gastric cancer	Likely benign; Benign	rs187038614, rs12248860, rs148976883, rs200188195	RCV005916315 RCV005918850 RCV005906470 RCV005907508
Hereditary ataxia	Conflicting classifications of pathogenicity	rs201865099	RCV005626306
Intellectual disability	Likely benign	rs1844750557	RCV001252290
Long QT syndrome	Likely benign	rs796052144	RCV000190130
Lung cancer	Benign; Likely benign	rs12248860, rs75876570	RCV005918854 RCV005892318
Malignant tumor of esophagus	Likely benign; Benign	rs187038614, rs75382300, rs148976883	RCV005916312 RCV005925303 RCV005906468
Melanoma	Likely benign	rs148976883	RCV005906471
Optic atrophy	Conflicting classifications of pathogenicity	rs200410468	RCV004813964
Ovarian serous cystadenocarcinoma	Benign; Likely benign	rs12248860, rs200188195	RCV005918851 RCV005907509
Sarcoma	Benign; Likely benign	rs7067733, rs540078122, rs187038614, rs75382300	RCV005912977 RCV005914744 RCV005916314 RCV005925304
Thymoma	Benign; Likely benign	rs7067733, rs187038614, rs12248860, rs10882089, rs75382300	RCV005912979 RCV005916317 RCV005918853 RCV005924805 RCV005925306
Uterine carcinosarcoma	Benign; Likely benign	rs7067733, rs187038614, rs12248860, rs10882089, rs75382300	RCV005912978 RCV005916316 RCV005918852 RCV005924804 RCV005925305
Uterine corpus endometrial carcinoma	Benign	rs7067733, rs113197692	RCV005912980 RCV005920436

Show/Hide Text Mining Associations (97)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Adenocarcinoma of Lung	Stimulate	37330525
Adenocarcinoma of Lung	Associate	37619315
Aicardi Syndrome	Associate	39187757
Albinism	Associate	39596324
Allan Herndon Dudley syndrome	Associate	36611072
Alzheimer Disease	Associate	23036584
Arthritis Rheumatoid	Associate	32840301, 34079550
Astigmatism	Associate	39187757
Ataxia Telangiectasia	Associate	35782055
Attention Deficit Disorder with Hyperactivity	Associate	35052433
Auditory Perceptual Disorders	Associate	35052433
Brain Neoplasms	Associate	38256095
Breast Neoplasms	Associate	32210727, 32346924, 32616754, 33285689, 34675265
Carcinogenesis	Associate	18845538, 21303978, 35403252, 35782055, 36742345
Carcinoma Adenoid Cystic	Associate	31914060
Carcinoma Hepatocellular	Associate	28684886, 28901309, 33111935, 34257537, 34359867, 36120772
Carcinoma Large Cell	Associate	28993508
Carcinoma Non Small Cell Lung	Associate	28101582, 31805030, 34825846
Carcinoma Pancreatic Ductal	Associate	35403252, 35619540
Carcinoma Renal Cell	Associate	30819726, 35979754
Carcinoma Squamous Cell	Associate	28993508
Cataract	Associate	39187757
Cholangiocarcinoma	Associate	36123339
Chorioretinitis	Associate	22653704, 35456519, 36672954
Ciliopathies	Associate	39596324
Colorectal Neoplasms	Associate	34575892, 36611072
COVID 19	Associate	33839760, 36389792, 36856850
Diabetes Mellitus Type 2	Associate	19862325, 22506066, 22998375
Diabetic Retinopathy	Associate	28821857, 32290826
Drug Related Side Effects and Adverse Reactions	Associate	32346924
Ependymoma	Associate	20885975
Epilepsy	Associate	24281367
Esotropia	Associate	39187757
Eye Abnormalities	Associate	24281367
Familial Exudative Vitreoretinopathies	Associate	27212378, 30181612, 33137195, 34128965, 34526760, 34860240, 34924743, 35456519, 35876299, 37089697
Fever	Associate	33537819
Genomic Instability	Associate	34575892
Glioblastoma	Associate	28993509, 33491154
Glioma	Associate	33491154, 35774141
Gyrate Atrophy	Associate	39596324
Heart Diseases	Associate	24281367
Hematologic Neoplasms	Inhibit	16627469
Hepatitis B	Associate	33102593, 33376723
HIV Infections	Associate	36389792
Hypertensive Retinopathy	Associate	35456519, 36672954
Hypoxia	Associate	34526760
Insulin Resistance	Associate	22998375
Intellectual Disability	Associate	25934493, 25996076, 27212378, 37089697, 39187757
Laryngeal Neoplasms	Associate	35312942
Learning Disabilities	Associate	24281367
Liver Cirrhosis	Associate	28684886
Lung Neoplasms	Associate	28993508, 32831194
Lupus Erythematosus Systemic	Associate	34079550
Lymphedema	Associate	22284827, 22653704, 25996076, 27212378, 39187757
Lymphoma Non Hodgkin	Associate	36945359
Mesothelioma Malignant	Associate	27279560
Microcephaly	Associate	22284827, 22653704, 24281367, 25934493, 27212378, 30181612, 33137195, 37089697
Microcephaly autosomal dominant	Associate	22284827
Microcephaly with Chorioretinopathy Autosomal Dominant	Associate	22284827, 33137195, 39187757
Mouth Neoplasms	Associate	29115586
Multiple Myeloma	Associate	16627469
Myopia	Associate	29346494
Neoplasm Metastasis	Associate	36611072
Neoplasms	Associate	23034402, 24074379, 24222652, 25277178, 28993508, 30819726, 33491154, 34359867, 34575892, 35164221, 35619540
Neoplasms	Stimulate	36742345
Neuroectodermal Tumors Primitive	Associate	36524840
Neurofibrosarcoma	Associate	37837931
Norrie disease	Associate	35328049, 37089697
Ovarian Neoplasms	Associate	31871312, 31987036, 32693821, 34253236
Pancreatic Neoplasms	Associate	21986572, 35403252
Parkinson Disease	Associate	18845538
Peripheral Nervous System Diseases	Associate	35456519
Peripheral Vascular Diseases	Associate	34128965
Pituitary Neoplasms	Associate	24222652
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	37656243
Prostate Cancer Hereditary 7	Associate	25277178
Prostatic Neoplasms	Associate	20515952, 25277178
Retinal Cone Dystrophy 1	Associate	39596324
Retinal Detachment	Associate	34128965, 34526760, 36672954
Retinal Diseases	Associate	25996076, 33137195
Retinal Dystrophies	Associate	39596324
Retinitis	Associate	35456519, 36672954
Retinoblastoma	Associate	33217867
Simpson Golabi Behmel syndrome	Associate	22998375
Squamous Cell Carcinoma of Head and Neck	Associate	35312942
Stomach Neoplasms	Associate	31683688, 33537819, 35164221, 35421138
Sveinsson Chorioretinal Atrophy	Associate	31077665, 33137195
Syndrome	Associate	25996076
Thyroid Carcinoma Anaplastic	Associate	33025856
Tongue Diseases	Associate	22653704
Triple Negative Breast Neoplasms	Associate	34582664
Urinary Bladder Neoplasms	Associate	22361733, 35669725
Urinary Bladder Neoplasms	Stimulate	33217824
Uterine Cervical Neoplasms	Associate	30816541
Vision Disorders	Associate	36672954
von Hippel Lindau Disease	Associate	30819726
Xeroderma Pigmentosum	Associate	35977011

KIF11 (kinesin family member 11)