Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
3831
Gene name Gene Name - the full gene name approved by the HGNC.
Kinesin light chain 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
KLC1
Synonyms (NCBI Gene) Gene synonyms aliases
KLC, KNS2, KNS2A
Chromosome Chromosome number
14
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
14q32.33
Summary Summary of gene provided in NCBI Entrez Gene.
Conventional kinesin is a tetrameric molecule composed of two heavy chains and two light chains, and transports various cargos along microtubules toward their plus ends. The heavy chains provide the motor activity, while the light chains bind to various c
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT004189 hsa-miR-197-3p Microarray 16822819
MIRT025439 hsa-miR-34a-5p Proteomics 21566225
MIRT1095542 hsa-miR-105 CLIP-seq
MIRT1095543 hsa-miR-1289 CLIP-seq
MIRT1095544 hsa-miR-1321 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0003774 Function Cytoskeletal motor activity TAS 8786116
GO:0005515 Function Protein binding IPI 14970196, 16938850, 17332754, 19861499, 25416956, 25898167, 32296183, 32814053, 36217029
GO:0005737 Component Cytoplasm IBA
GO:0005737 Component Cytoplasm IEA
GO:0005829 Component Cytosol ISS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
600025 6387 ENSG00000126214
Protein
UniProt ID Q07866
Protein name Kinesin light chain 1 (KLC 1)
Protein function Kinesin is a microtubule-associated force-producing protein that may play a role in organelle transport (PubMed:21385839). The light chain may function in coupling of cargo to the heavy chain or in the modulation of its ATPase activity (By simil
PDB 3NF1 , 5OJ8 , 7AI4 , 7AIE
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13424 TPR_12 211 287 Repeat
PF00515 TPR_1 297 329 Tetratricopeptide repeat Repeat
PF13374 TPR_10 463 502 Repeat
Tissue specificity TISSUE SPECIFICITY: Found in a variety of tissues. Mostly abundant in brain and spine. {ECO:0000269|PubMed:14970196}.
Sequence
MYDNMSTMVYIKEDKLEKLTQDEIISKTKQVIQGLEALKNEHNSILQSLLETLKCLKKDD
ESNLVEEKSNMIRKSLEMLELGLSEAQVMMALSNHLNAVESEKQKLRAQVRRLCQENQWL
RDELANTQQKLQKSEQSVAQLEEEKKHLEFMNQLKKYDDDISPSEDKDTDSTKEPLDDLF
PNDEDDPGQGIQQQHSSAAAAAQQGGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQAL
EDLEKTSGHDHPDVATMLNILALVYRDQNKYKDAANLLNDALAIREK
TLGKDHPAVAATL
NNLAVLYGKRGKYKEAEPLCKRALEIREK
VLGKDHPDVAKQLNNLALLCQNQGKYEEVEY
YYQRALEIYQTKLGPDDPNVAKTKNNLASCYLKQGKFKQAETLYKEILTRAHEREFGSVD
DENKPIWMHAEEREECKGKQKDGTSFGEYGGWYKACKVDSPTVTTTLKNLGALYRRQGKF
EAAETLEEAAMRSRKQGLDNVH
KQRVAEVLNDPENMEKRRSRESLNVDVVKYESGPDGGE
EVSMSVEWNGGVSGRASFCGKRQQQQWPGRRHR
Sequence length 573
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Motor proteins
Alzheimer disease
Parkinson disease
Amyotrophic lateral sclerosis
Huntington disease
Prion disease
Pathways of neurodegeneration - multiple diseases
Salmonella infection
  MHC class II antigen presentation
RHO GTPases activate KTN1
COPI-dependent Golgi-to-ER retrograde traffic
Kinesins
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Alzheimer disease Alzheimer's disease or family history of Alzheimer's disease N/A N/A GWAS
Breast Cancer Breast cancer N/A N/A GWAS
Gout Gout N/A N/A GWAS
Insomnia Insomnia N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Alzheimer Disease Associate 17653041, 22272245
Carcinoma Non Small Cell Lung Associate 31753813
Cataract Associate 17653041, 25883527
Cataract Age Related Nuclear Associate 17653041, 23776437, 25883527
Cataract posterior polar 1 Associate 25883527
Coronary Artery Disease Associate 40026415
Histiocytosis Langerhans Cell Associate 39727013
Lung Neoplasms Associate 31753813
Neoplasms Associate 27272132
Neurodegenerative Diseases Associate 22272245