Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
3815
Gene name Gene Name - the full gene name approved by the HGNC.
KIT proto-oncogene, receptor tyrosine kinase
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
KIT
Synonyms (NCBI Gene) Gene synonyms aliases
C-Kit, CD117, MASTC, PBT, SCFR
Chromosome Chromosome number
4
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
4q12
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a receptor tyrosine kinase. This gene was initially identified as a homolog of the feline sarcoma viral oncogene v-kit and is often referred to as proto-oncogene c-Kit. The canonical form of this glycosylated transmembrane protein has an
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs28933371 T>G Pathogenic Missense variant, coding sequence variant
rs121913234 AAACCCATGTATGAAGTACAGTGGAAG>- Pathogenic Coding sequence variant, splice acceptor variant
rs121913235 T>A,C,G Pathogenic, likely-pathogenic Missense variant, coding sequence variant
rs121913505 G>A Likely-benign, uncertain-significance, likely-pathogenic Missense variant, coding sequence variant
rs121913506 G>A,C,T Other, pathogenic, likely-pathogenic Missense variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT001780 hsa-miR-221-3p qRT-PCR, Western blot 19126397
MIRT001780 hsa-miR-221-3p Luciferase reporter assay 18246122
MIRT001780 hsa-miR-221-3p Luciferase reporter assay 18983236
MIRT001779 hsa-miR-222-3p Luciferase reporter assay 18246122
MIRT001779 hsa-miR-222-3p Luciferase reporter assay 18983236
Transcription factors
Transcription factor Regulation Reference
MITF Activation 19937254
RBMX Repression 16707624
SP1 Unknown 9834219
TFAP2A Unknown 20805990
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000166 Function Nucleotide binding IEA
GO:0001541 Process Ovarian follicle development IEA
GO:0001541 Process Ovarian follicle development ISS
GO:0001650 Component Fibrillar center IDA
GO:0001669 Component Acrosomal vesicle IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
164920 6342 ENSG00000157404
Protein
UniProt ID P10721
Protein name Mast/stem cell growth factor receptor Kit (SCFR) (EC 2.7.10.1) (Piebald trait protein) (PBT) (Proto-oncogene c-Kit) (Tyrosine-protein kinase Kit) (p145 c-kit) (v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog) (CD antigen CD117)
Protein function Tyrosine-protein kinase that acts as a cell-surface receptor for the cytokine KITLG/SCF and plays an essential role in the regulation of cell survival and proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development,
PDB 1PKG , 1T45 , 1T46 , 2E9W , 2EC8 , 2IUH , 2VIF , 3G0E , 3G0F , 4HVS , 4K94 , 4K9E , 4PGZ , 4U0I , 6GQJ , 6GQK , 6GQL , 6GQM , 6HH1 , 6ITT , 6ITV , 6KLA , 6MOB , 6XV9 , 6XVA , 6XVB , 7KHG , 7KHJ , 7KHK , 7ZW8 , 7ZY6 , 8DFM , 8DFP , 8DFQ , 8PQ9 , 8PQA , 8PQB , 8PQC , 8PQD , 8PQE , 8PQF , 8PQG
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00047 ig 216 305 Immunoglobulin domain Domain
PF07714 PK_Tyr_Ser-Thr 589 924 Protein tyrosine and serine/threonine kinase Domain
Tissue specificity TISSUE SPECIFICITY: [Isoform 3]: In testis, detected in spermatogonia in the basal layer and in interstitial Leydig cells but not in Sertoli cells or spermatocytes inside the seminiferous tubules (at protein level) (PubMed:20601678). Expression is maintai
Sequence
MRGARGAWDFLCVLLLLLRVQTGSSQPSVSPGEPSPPSIHPGKSDLIVRVGDEIRLLCTD
PGFVKWTFEILDETNENKQNEWITEKAEATNTGKYTCTNKHGLSNSIYVFVRDPAKLFLV
DRSLYGKEDNDTLVRCPLTDPEVTNYSLKGCQGKPLPKDLRFIPDPKAGIMIKSVKRAYH
RLCLHCSVDQEGKSVLSEKFILKVRPAFKAVPVVSVSKASYLLREGEEFTVTCTIKDVSS
SVYSTWKRENSQTKLQEKYNSWHHGDFNYERQATLTISSARVNDSGVFMCYANNTFGSAN
VTTTL
EVVDKGFINIFPMINTTVFVNDGENVDLIVEYEAFPKPEHQQWIYMNRTFTDKWE
DYPKSENESNIRYVSELHLTRLKGTEGGTYTFLVSNSDVNAAIAFNVYVNTKPEILTYDR
LVNGMLQCVAAGFPEPTIDWYFCPGTEQRCSASVLPVDVQTLNSSGPPFGKLVVQSSIDS
SAFKHNGTVECKAYNDVGKTSAYFNFAFKGNNKEQIHPHTLFTPLLIGFVIVAGMMCIIV
MILTYKYLQKPMYEVQWKVVEEINGNNYVYIDPTQLPYDHKWEFPRNRLSFGKTLGAGAF
GKVVEATAYGLIKSDAAMTVAVKMLKPSAHLTEREALMSELKVLSYLGNHMNIVNLLGAC
TIGGPTLVITEYCCYGDLLNFLRRKRDSFICSKQEDHAEAALYKNLLHSKESSCSDSTNE
YMDMKPGVSYVVPTKADKRRSVRIGSYIERDVTPAIMEDDELALDLEDLLSFSYQVAKGM
AFLASKNCIHRDLAARNILLTHGRITKICDFGLARDIKNDSNYVVKGNARLPVKWMAPES
IFNCVYTFESDVWSYGIFLWELFSLGSSPYPGMPVDSKFYKMIKEGFRMLSPEHAPAEMY
DIMKTCWDADPLKRPTFKQIVQLI
EKQISESTNHIYSNLANCSPNRQKPVVDHSVRINSV
GSTASSSQPLLVHDDV
Sequence length 976
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
Phospholipase D signaling pathway
PI3K-Akt signaling pathway
Hematopoietic cell lineage
Melanogenesis
Pathways in cancer
Acute myeloid leukemia
Breast cancer
Central carbon metabolism in cancer
  PIP3 activates AKT signaling
Signaling by SCF-KIT
Regulation of KIT signaling
Constitutive Signaling by Aberrant PI3K in Cancer
RAF/MAP kinase cascade
PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling
TFAP2 (AP-2) family regulates transcription of growth factors and their receptors
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Cutaneous mastocytosis cutaneous mastocytosis rs753212327, rs121913517, rs993022333 N/A
Dysgerminoma dysgerminoma rs121913506 N/A
Gastrointestinal stromal tumor gastrointestinal stromal tumor rs1057520032, rs1560417535, rs1057519708, rs1553887960, rs1560417642, rs1560417666, rs1057519710, rs1560395607, rs121913680, rs1560417673, rs1560418178, rs1577992594, rs121913517, rs121913514, rs1577995761
View all (20 more)
N/A
Piebaldism piebaldism, Piebaldism, progressive, Piebaldism with sensorineural deafness rs794726672, rs121913687, rs794726673, rs121913680, rs28933371, rs794726674, rs1560418178, rs794726675, rs387907217, rs1560419312, rs121913679, rs121913684 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
acute myeloid leukemia Acute myeloid leukemia N/A N/A ClinVar
Bipolar Disorder Bipolar disorder N/A N/A GWAS
hereditary cancer Hereditary cancer N/A N/A ClinVar
Lip and Oral Cavity Carcinoma lip and oral cavity carcinoma N/A N/A ClinVar
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Abdominal Injuries Associate 24186140, 26017288
Abdominal Pain Associate 11065242
Acute erythroleukemia Associate 36357474
Adenocarcinoma Associate 20305619, 23696935, 25732813, 26315110, 26643918, 29018259, 34449929
Adenocarcinoma Follicular Associate 16570574, 27329729, 31032340
Adenocarcinoma of Lung Associate 15627886, 27356570
Adenolymphoma Associate 27151705
Adenoma Associate 12738950, 16570574, 25923053, 8574299
Adenoma Islet Cell Associate 17229322
Adenoma Oxyphilic Associate 17683191, 34802045