Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
3798
Gene name Gene Name - the full gene name approved by the HGNC.
Kinesin family member 5A
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
KIF5A
Synonyms (NCBI Gene) Gene synonyms aliases
ALS25, D12S1889, MY050, NEIMY, NKHC, SPG10
Chromosome Chromosome number
12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
12q13.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the kinesin family of proteins. Members of this family are part of a multisubunit complex that functions as a microtubule motor in intracellular organelle transport. Mutations in this gene cause autosomal dominant spastic par
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs121434441 A>G Pathogenic Non coding transcript variant, coding sequence variant, missense variant
rs121434442 C>T Pathogenic, likely-pathogenic Non coding transcript variant, coding sequence variant, missense variant
rs121434443 A>G Pathogenic, likely-pathogenic Non coding transcript variant, coding sequence variant, missense variant
rs121434444 C>T Pathogenic Non coding transcript variant, coding sequence variant, missense variant
rs139091551 G>A,T Conflicting-interpretations-of-pathogenicity, likely-benign Synonymous variant, non coding transcript variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT027231 hsa-miR-103a-3p Sequencing 20371350
MIRT032072 hsa-miR-16-5p Sequencing 20371350
MIRT656870 hsa-miR-3606-3p HITS-CLIP 23824327
MIRT656869 hsa-miR-513a-3p HITS-CLIP 23824327
MIRT656868 hsa-miR-513c-3p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000166 Function Nucleotide binding IEA
GO:0003774 Function Cytoskeletal motor activity TAS 7514426
GO:0003777 Function Microtubule motor activity IDA 18203753
GO:0003777 Function Microtubule motor activity IEA
GO:0005515 Function Protein binding IPI 20386726, 22705394, 24161670, 25898167, 33961781
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
602821 6323 ENSG00000155980
Protein
UniProt ID Q12840
Protein name Kinesin heavy chain isoform 5A (EC 5.6.1.3) (Kinesin heavy chain neuron-specific 1) (Neuronal kinesin heavy chain) (NKHC)
Protein function Microtubule-dependent motor required for slow axonal transport of neurofilament proteins (NFH, NFM and NFL). Can induce formation of neurite-like membrane protrusions in non-neuronal cells in a ZFYVE27-dependent manner. The ZFYVE27-KIF5A complex
PDB 4UXT , 4UXY , 4UY0
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00225 Kinesin 25 327 Kinesin motor domain Domain
Tissue specificity TISSUE SPECIFICITY: Distributed throughout the CNS but is highly enriched in subsets of neurons. {ECO:0000269|PubMed:7514426}.
Sequence
MAETNNECSIKVLCRFRPLNQAEILRGDKFIPIFQGDDSVVIGGKPYVFDRVFPPNTTQE
QVYHACAMQIVKDVLAGYNGTIFAYGQTSSGKTHTMEGKLHDPQLMGIIPRIARDIFNHI
YSMDENLEFHIKVSYFEIYLDKIRDLLDVTKTNLSVHEDKNRVPFVKGCTERFVSSPEEI
LDVIDEGKSNRHVAVTNMNEHSSRSHSIFLINIKQENMETEQKLSGKLYLVDLAGSEKVS
KTGAEGAVLDEAKNINKSLSALGNVISALAEGTKSYVPYRDSKMTRILQDSLGGNCRTTM
FICCSPSSYNDAETKSTLMFGQRAKTI
KNTASVNLELTAEQWKKKYEKEKEKTKAQKETI
AKLEAELSRWRNGENVPETERLAGEEAALGAELCEETPVNDNSSIVVRIAPEERQKYEEE
IRRLYKQLDDKDDEINQQSQLIEKLKQQMLDQEELLVSTRGDNEKVQRELSHLQSENDAA
KDEVKEVLQALEELAVNYDQKSQEVEEKSQQNQLLVDELSQKVATMLSLESELQRLQEVS
GHQRKRIAEVLNGLMKDLSEFSVIVGNGEIKLPVEISGAIEEEFTVARLYISKIKSEVKS
VVKRCRQLENLQVECHRKMEVTGRELSSCQLLISQHEAKIRSLTEYMQSVELKKRHLEES
YDSLSDELAKLQAQETVHEVALKDKEPDTQDADEVKKALELQMESHREAHHRQLARLRDE
INEKQKTIDELKDLNQKLQLELEKLQADYEKLKSEEHEKSTKLQELTFLYERHEQSKQDL
KGLEETVARELQTLHNLRKLFVQDVTTRVKKSAEMEPEDSGGIHSQKQKISFLENNLEQL
TKVHKQLVRDNADLRCELPKLEKRLRATAERVKALEGALKEAKEGAMKDKRRYQQEVDRI
KEAVRYKSSGKRGHSAQIAKPVRPGHYPASSPTNPYGTRSPECISYTNSLFQNYQNLYLQ
ATPSSTSDMYFANSCTSSGATSSGGPLASYQKANMDNGNATDINDNRSDLPCGYEAEDQA
KLFPLHQETAAS
Sequence length 1032
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Endocytosis
Dopaminergic synapse
Motor proteins
Alzheimer disease
Parkinson disease
Amyotrophic lateral sclerosis
Huntington disease
Prion disease
Pathways of neurodegeneration - multiple diseases
Salmonella infection
Non-small cell lung cancer
  MHC class II antigen presentation
RHO GTPases activate KTN1
COPI-dependent Golgi-to-ER retrograde traffic
Kinesins
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Amyotrophic Lateral Sclerosis Amyotrophic lateral sclerosis, susceptibility to, 25 rs1402429085, rs1555179091, rs1555179087 N/A
Hereditary spastic paraplegia Hereditary spastic paraplegia 10, Hereditary spastic paraplegia rs1555177629, rs121434442, rs387907288, rs1555177824, rs1555177831, rs121434443, rs387907289, rs1131692233, rs690016545, rs387907285, rs387907287, rs121434441 N/A
Myoclonus myoclonus, intractable, neonatal rs1057519078, rs1057517673, rs387907285, rs387907287 N/A
Spastic Paraplegia spastic paraplegia rs1555179087, rs1565705251, rs121434442, rs1594915468, rs387907288, rs1594925773, rs139015012, rs121434443, rs1555178616, rs1882179247, rs1555179091, rs387907285, rs1402429085, rs1060502523, rs387907287
View all (1 more)
N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Charcot-Marie-Tooth Disease autosomal dominant Charcot-Marie-Tooth disease type 2 due to KIF5A mutation N/A N/A GenCC
Diabetes Type 2 diabetes N/A N/A GWAS
Frontotemporal Dementia With Or Without Amyotrophic Lateral Sclerosis frontotemporal dementia and/or amyotrophic lateral sclerosis 4 N/A N/A ClinVar
Insomnia Insomnia N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 39517115
Alcoholic Neuropathy Associate 25008398
Alzheimer Disease Associate 36544231
Amyotrophic Lateral Sclerosis Associate 25957632, 29342275, 30778698, 33709219, 33829936, 36055117, 36565680, 37386082
Amyotrophic lateral sclerosis 1 Associate 29342275
Apnea Associate 27463701
Arthritis Juvenile Associate 19674979
Arthritis Rheumatoid Associate 18794857, 19956108, 23242182
Basal Ganglia Diseases Associate 25957632
Charcot Marie Tooth disease X linked recessive 2 Associate 29566793, 33829936, 36565680