Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	3791
Gene name	Kinase insert domain receptor
Gene symbol	KDR
Synonyms (NCBI Gene)	CD309FLK1VEGFRVEGFR2
Chromosome	4
Chromosome location	4q12
Summary	Vascular endothelial growth factor (VEGF) is a major growth factor for endothelial cells. This gene encodes one of the two receptors of the VEGF. This receptor, known as kinase insert domain receptor, is a type III receptor tyrosine kinase. It functions a

Show/Hide all (2)

SNP ID	Visualize variation	Clinical significance	Consequence
rs34231037	A>G	Likely-benign, risk-factor	Missense variant, coding sequence variant
rs121917766	G>A,C	Not-provided, pathogenic	Missense variant, coding sequence variant

117

Show/Hide all (117)

miRTarBase ID	miRNA	Experiments	Reference
MIRT006277	hsa-miR-19b-1-5p	Luciferase reporter assay	22197821
MIRT006442	hsa-miR-200b-3p	Luciferase reporter assayWestern blot	21544626
MIRT006277	hsa-miR-19b-1-5p	Luciferase reporter assay	22197821
MIRT006442	hsa-miR-200b-3p	Luciferase reporter assayWestern blot	21544626
MIRT006277	hsa-miR-19b-1-5p	Luciferase reporter assay	22197821
MIRT006442	hsa-miR-200b-3p	Luciferase reporter assayWestern blot	21544626
MIRT006794	hsa-miR-16-5p	Luciferase reporter assayqRT-PCRWestern blot	21885851
MIRT016978	hsa-miR-335-5p	Microarray	18185580
MIRT052945	hsa-miR-1236-3p	qRT-PCRWestern blot	22223733
MIRT053084	hsa-miR-17-3p	Luciferase reporter assayqRT-PCRWestern blot	23258273
MIRT006442	hsa-miR-200b-3p	Luciferase reporter assayqRT-PCRWestern blot	22499991
MIRT006442	hsa-miR-200b-3p	Luciferase reporter assayqRT-PCRWestern blot	22499991
MIRT437786	hsa-miR-15b-5p	Luciferase reporter assayqRT-PCRWestern blot	23688497
MIRT531796	hsa-miR-548aa	PAR-CLIP	22012620
MIRT531795	hsa-miR-548ap-3p	PAR-CLIP	22012620
MIRT531794	hsa-miR-548t-3p	PAR-CLIP	22012620
MIRT531793	hsa-miR-548as-3p	PAR-CLIP	22012620
MIRT531792	hsa-miR-548at-3p	PAR-CLIP	22012620
MIRT531791	hsa-miR-548ay-3p	PAR-CLIP	22012620
MIRT531790	hsa-miR-4799-5p	PAR-CLIP	22012620
MIRT733145	hsa-miR-155-5p	qRT-PCR	31766503
MIRT733148	hsa-miR-34a-5p	qRT-PCR	31766503
MIRT734456	hsa-miR-338-3p	Immunoprecipitaion (IP)Luciferase reporter assayqRT-PCRWestern blotting	33837886
MIRT531796	hsa-miR-548aa	PAR-CLIP	22012620
MIRT531795	hsa-miR-548ap-3p	PAR-CLIP	22012620
MIRT531794	hsa-miR-548t-3p	PAR-CLIP	22012620
MIRT531793	hsa-miR-548as-3p	PAR-CLIP	22012620
MIRT531792	hsa-miR-548at-3p	PAR-CLIP	22012620
MIRT531791	hsa-miR-548ay-3p	PAR-CLIP	22012620
MIRT531790	hsa-miR-4799-5p	PAR-CLIP	22012620
MIRT756468	hsa-miR-182-5p	qRT-PCR	38796528
MIRT1085014	hsa-miR-1224-3p	CLIP-seq
MIRT1085015	hsa-miR-1260	CLIP-seq
MIRT1085016	hsa-miR-1260b	CLIP-seq
MIRT1085017	hsa-miR-1280	CLIP-seq
MIRT1085018	hsa-miR-1343	CLIP-seq
MIRT1085019	hsa-miR-1909	CLIP-seq
MIRT1085020	hsa-miR-214	CLIP-seq
MIRT1085021	hsa-miR-3140-3p	CLIP-seq
MIRT1085022	hsa-miR-3192	CLIP-seq
MIRT1085023	hsa-miR-328	CLIP-seq
MIRT1085024	hsa-miR-3619-5p	CLIP-seq
MIRT1085025	hsa-miR-3646	CLIP-seq
MIRT1085026	hsa-miR-378g	CLIP-seq
MIRT1085027	hsa-miR-4253	CLIP-seq
MIRT1085028	hsa-miR-4437	CLIP-seq
MIRT1085029	hsa-miR-4674	CLIP-seq
MIRT1085030	hsa-miR-4710	CLIP-seq
MIRT1085031	hsa-miR-4786-5p	CLIP-seq
MIRT1085032	hsa-miR-4792	CLIP-seq
MIRT1085033	hsa-miR-532-3p	CLIP-seq
MIRT1085034	hsa-miR-558	CLIP-seq
MIRT1085035	hsa-miR-583	CLIP-seq
MIRT1085036	hsa-miR-761	CLIP-seq
MIRT1085037	hsa-miR-769-5p	CLIP-seq
MIRT1085014	hsa-miR-1224-3p	CLIP-seq
MIRT1085015	hsa-miR-1260	CLIP-seq
MIRT1085016	hsa-miR-1260b	CLIP-seq
MIRT1085017	hsa-miR-1280	CLIP-seq
MIRT2021635	hsa-miR-1298	CLIP-seq
MIRT1085018	hsa-miR-1343	CLIP-seq
MIRT2021636	hsa-miR-149	CLIP-seq
MIRT2021637	hsa-miR-3064-5p	CLIP-seq
MIRT1085022	hsa-miR-3192	CLIP-seq
MIRT2021638	hsa-miR-3616-5p	CLIP-seq
MIRT2021639	hsa-miR-3647-5p	CLIP-seq
MIRT1085026	hsa-miR-378g	CLIP-seq
MIRT1085028	hsa-miR-4437	CLIP-seq
MIRT1085029	hsa-miR-4674	CLIP-seq
MIRT2021640	hsa-miR-4773	CLIP-seq
MIRT2021641	hsa-miR-4775	CLIP-seq
MIRT2021642	hsa-miR-4794	CLIP-seq
MIRT1085033	hsa-miR-532-3p	CLIP-seq
MIRT1085034	hsa-miR-558	CLIP-seq
MIRT2021643	hsa-miR-573	CLIP-seq
MIRT2021644	hsa-miR-590-3p	CLIP-seq
MIRT2021645	hsa-miR-664	CLIP-seq
MIRT1085014	hsa-miR-1224-3p	CLIP-seq
MIRT1085015	hsa-miR-1260	CLIP-seq
MIRT1085016	hsa-miR-1260b	CLIP-seq
MIRT1085017	hsa-miR-1280	CLIP-seq
MIRT1085018	hsa-miR-1343	CLIP-seq
MIRT2021636	hsa-miR-149	CLIP-seq
MIRT2021637	hsa-miR-3064-5p	CLIP-seq
MIRT1085022	hsa-miR-3192	CLIP-seq
MIRT2253149	hsa-miR-3545-3p	CLIP-seq
MIRT2021638	hsa-miR-3616-5p	CLIP-seq
MIRT2021639	hsa-miR-3647-5p	CLIP-seq
MIRT2253150	hsa-miR-3663-5p	CLIP-seq
MIRT1085026	hsa-miR-378g	CLIP-seq
MIRT2253151	hsa-miR-3942-3p	CLIP-seq
MIRT1085028	hsa-miR-4437	CLIP-seq
MIRT2253152	hsa-miR-4635	CLIP-seq
MIRT1085029	hsa-miR-4674	CLIP-seq
MIRT2253153	hsa-miR-4680-5p	CLIP-seq
MIRT2021640	hsa-miR-4773	CLIP-seq
MIRT2021641	hsa-miR-4775	CLIP-seq
MIRT2021642	hsa-miR-4794	CLIP-seq
MIRT1085033	hsa-miR-532-3p	CLIP-seq
MIRT1085034	hsa-miR-558	CLIP-seq
MIRT2021643	hsa-miR-573	CLIP-seq
MIRT2021644	hsa-miR-590-3p	CLIP-seq
MIRT2253154	hsa-miR-618	CLIP-seq
MIRT2253155	hsa-miR-642b	CLIP-seq
MIRT1085022	hsa-miR-3192	CLIP-seq
MIRT1085034	hsa-miR-558	CLIP-seq
MIRT2452340	hsa-miR-3155	CLIP-seq
MIRT2452341	hsa-miR-3155b	CLIP-seq
MIRT2452342	hsa-miR-3925-3p	CLIP-seq
MIRT2452343	hsa-miR-484	CLIP-seq
MIRT2452344	hsa-miR-586	CLIP-seq
MIRT2465523	hsa-miR-338-5p	CLIP-seq
MIRT2465524	hsa-miR-369-3p	CLIP-seq
MIRT2465525	hsa-miR-374c	CLIP-seq
MIRT2465526	hsa-miR-4666-3p	CLIP-seq
MIRT2465527	hsa-miR-576-3p	CLIP-seq
MIRT2465528	hsa-miR-655	CLIP-seq

Show/Hide all (11)

Transcription factor	Regulation	Reference
E2F1	Unknown	20516113
ESR1	Activation	16574784
HEY1	Repression	16782059;17028039;18694572
NANOG	Activation	21119109
NANOG	Activation	21119109
PTTG1	Activation	16926250
SP1	Repression	16678129
SP3	Activation	16574784
SP3	Repression	16678129
SP4	Activation	16574784
SP4	Repression	16678129

145

Show/Hide all (145)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0001525	Process	Angiogenesis	IBA
GO:0001525	Process	Angiogenesis	IEA
GO:0001525	Process	Angiogenesis	TAS	10022831
GO:0001541	Process	Ovarian follicle development	IEA
GO:0001569	Process	Branching involved in blood vessel morphogenesis	IMP	23688497
GO:0001570	Process	Vasculogenesis	IEA
GO:0001570	Process	Vasculogenesis	ISS
GO:0001934	Process	Positive regulation of protein phosphorylation	IDA	19033661
GO:0001938	Process	Positive regulation of endothelial cell proliferation	IEA
GO:0001938	Process	Positive regulation of endothelial cell proliferation	IMP	10022831, 11387210
GO:0001944	Process	Vasculature development	IEA
GO:0001945	Process	Lymph vessel development	IEA
GO:0002053	Process	Positive regulation of mesenchymal cell proliferation	IEA
GO:0002070	Process	Epithelial cell maturation	IEA
GO:0003157	Process	Endocardium development	IEA
GO:0003158	Process	Endothelium development	IEA
GO:0003158	Process	Endothelium development	ISS
GO:0004672	Function	Protein kinase activity	IEA
GO:0004713	Function	Protein tyrosine kinase activity	EXP	7999104, 9398617, 10037737, 15962004
GO:0004713	Function	Protein tyrosine kinase activity	IDA	10037737
GO:0004713	Function	Protein tyrosine kinase activity	IEA
GO:0004714	Function	Transmembrane receptor protein tyrosine kinase activity	IEA
GO:0004714	Function	Transmembrane receptor protein tyrosine kinase activity	TAS	1417831
GO:0005021	Function	Vascular endothelial growth factor receptor activity	IBA
GO:0005021	Function	Vascular endothelial growth factor receptor activity	IDA	1417831, 10022831, 10102632, 11387210, 15215251
GO:0005021	Function	Vascular endothelial growth factor receptor activity	IEA
GO:0005178	Function	Integrin binding	IPI	10022831, 30873824
GO:0005515	Function	Protein binding	IPI	1417831, 12509223, 15985432, 16530705, 16763549, 16966330, 17222790, 17293873, 18377662, 18662404, 18936167, 18997771, 19033661, 20145116, 20224550, 20660291, 21130043, 21596751, 21653826, 21893193, 22789536, 22897854, 23374253, 23529610, 23583373, 24529377, 25187647, 25825981, 2589
GO:0005524	Function	ATP binding	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005768	Component	Endosome	IDA	23262137
GO:0005768	Component	Endosome	IEA
GO:0005769	Component	Early endosome	IEA
GO:0005769	Component	Early endosome	ISS
GO:0005783	Component	Endoplasmic reticulum	IDA	23529610
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005794	Component	Golgi apparatus	IDA	23262137
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	10102632, 23262137, 25825981
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0005886	Component	Plasma membrane	TAS	1656371
GO:0007169	Process	Cell surface receptor protein tyrosine kinase signaling pathway	IBA
GO:0007169	Process	Cell surface receptor protein tyrosine kinase signaling pathway	IEA
GO:0007169	Process	Cell surface receptor protein tyrosine kinase signaling pathway	TAS	1417831
GO:0008284	Process	Positive regulation of cell population proliferation	IBA
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	7929439
GO:0008360	Process	Regulation of cell shape	IDA	7929439
GO:0009897	Component	External side of plasma membrane	IEA
GO:0009986	Component	Cell surface	IEA
GO:0010463	Process	Mesenchymal cell proliferation	IEA
GO:0010595	Process	Positive regulation of endothelial cell migration	IEA
GO:0010595	Process	Positive regulation of endothelial cell migration	IMP	10022831
GO:0010629	Process	Negative regulation of gene expression	IDA	26879375
GO:0015026	Function	Coreceptor activity	IEA
GO:0016020	Component	Membrane	IEA
GO:0016239	Process	Positive regulation of macroautophagy	IGI	23798385
GO:0016301	Function	Kinase activity	IEA
GO:0016477	Process	Cell migration	IBA
GO:0016477	Process	Cell migration	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0018108	Process	Peptidyl-tyrosine phosphorylation	IDA	10037737, 10102632
GO:0019838	Function	Growth factor binding	IBA
GO:0019838	Function	Growth factor binding	IEA
GO:0019838	Function	Growth factor binding	IPI	1417831, 10022831
GO:0030054	Component	Cell junction	IEA
GO:0030054	Component	Cell junction	ISS
GO:0030097	Process	Hemopoiesis	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0030324	Process	Lung development	IEA
GO:0030335	Process	Positive regulation of cell migration	IBA
GO:0030335	Process	Positive regulation of cell migration	IDA	7929439
GO:0030513	Process	Positive regulation of BMP signaling pathway	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0035162	Process	Embryonic hemopoiesis	IEA
GO:0035162	Process	Embryonic hemopoiesis	ISS
GO:0035924	Process	Cellular response to vascular endothelial growth factor stimulus	IDA	10102632, 11387210, 19033661, 21885851, 23529610
GO:0036324	Process	Vascular endothelial growth factor receptor-2 signaling pathway	IMP	15215251, 24205206
GO:0038084	Process	Vascular endothelial growth factor signaling pathway	IDA	21885851
GO:0038084	Process	Vascular endothelial growth factor signaling pathway	IEA
GO:0038084	Process	Vascular endothelial growth factor signaling pathway	IMP	10022831, 23688497
GO:0038085	Function	Vascular endothelial growth factor binding	IPI	20660291, 25825981
GO:0042802	Function	Identical protein binding	IPI	17293873, 20080685, 20660291
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043129	Process	Surfactant homeostasis	IEA
GO:0043235	Component	Receptor complex	IBA
GO:0043408	Process	Regulation of MAPK cascade	IBA
GO:0043410	Process	Positive regulation of MAPK cascade	IDA	11387210
GO:0043524	Process	Negative regulation of neuron apoptotic process	IEA
GO:0043536	Process	Positive regulation of blood vessel endothelial cell migration	IMP	22499991, 23688497, 26879375
GO:0045121	Component	Membrane raft	IDA	23262137
GO:0045165	Process	Cell fate commitment	IEA
GO:0045296	Function	Cadherin binding	IPI	11950700, 25893857
GO:0045446	Process	Endothelial cell differentiation	IBA
GO:0045446	Process	Endothelial cell differentiation	IEA
GO:0045766	Process	Positive regulation of angiogenesis	IBA
GO:0045766	Process	Positive regulation of angiogenesis	IDA	23896411
GO:0045766	Process	Positive regulation of angiogenesis	IEA
GO:0045766	Process	Positive regulation of angiogenesis	IMP	26879375, 28637396
GO:0046777	Process	Protein autophosphorylation	IDA	10037737, 10102632, 19033661
GO:0048010	Process	Vascular endothelial growth factor receptor signaling pathway	IDA	10102632, 11387210, 21885851
GO:0048010	Process	Vascular endothelial growth factor receptor signaling pathway	IEA
GO:0048010	Process	Vascular endothelial growth factor receptor signaling pathway	IEA
GO:0048010	Process	Vascular endothelial growth factor receptor signaling pathway	IMP	23529610
GO:0048010	Process	Vascular endothelial growth factor receptor signaling pathway	TAS
GO:0048286	Process	Lung alveolus development	IEA
GO:0048597	Process	Post-embryonic camera-type eye morphogenesis	IEA
GO:0048754	Process	Branching morphogenesis of an epithelial tube	IEA
GO:0050673	Process	Epithelial cell proliferation	IEA
GO:0050679	Process	Positive regulation of epithelial cell proliferation	IEA
GO:0050927	Process	Positive regulation of positive chemotaxis	IDA	7929439
GO:0051879	Function	Hsp90 protein binding	TAS	19267251
GO:0051894	Process	Positive regulation of focal adhesion assembly	IDA	12820653
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	9804796
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IMP	24863063
GO:0051901	Process	Positive regulation of mitochondrial depolarization	IGI	23798385
GO:0055074	Process	Calcium ion homeostasis	IEA
GO:0060562	Process	Epithelial tube morphogenesis	IEA
GO:0060837	Process	Blood vessel endothelial cell differentiation	IEA
GO:0061042	Process	Vascular wound healing	IMP	22499991, 23688497
GO:0070161	Component	Anchoring junction	IEA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IEA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IMP	24863063
GO:0071526	Process	Semaphorin-plexin signaling pathway	IEA
GO:0071944	Component	Cell periphery	IEA
GO:0072089	Process	Stem cell proliferation	IEA
GO:0090050	Process	Positive regulation of cell migration involved in sprouting angiogenesis	IEA
GO:0090050	Process	Positive regulation of cell migration involved in sprouting angiogenesis	IMP	18977327, 24205206
GO:0090050	Process	Positive regulation of cell migration involved in sprouting angiogenesis	ISS
GO:0090141	Process	Positive regulation of mitochondrial fission	IGI	23798385
GO:0097443	Component	Sorting endosome	IEA
GO:0097443	Component	Sorting endosome	ISS
GO:0141150	Process	Positive regulation of nitric oxide-cGMP mediated signal transduction	IDA	10600473
GO:0141150	Process	Positive regulation of nitric oxide-cGMP mediated signal transduction	IMP	9837777
GO:1901532	Process	Regulation of hematopoietic progenitor cell differentiation	IEA
GO:1903010	Process	Regulation of bone development	IEA
GO:1904881	Process	Cellular response to hydrogen sulfide	IDA	26879375
GO:2000352	Process	Negative regulation of endothelial cell apoptotic process	IDA	9804796
GO:2000648	Process	Positive regulation of stem cell proliferation	IEA
GO:2001028	Process	Positive regulation of endothelial cell chemotaxis	IDA	21885851
GO:2001214	Process	Positive regulation of vasculogenesis	IEA
GO:2001214	Process	Positive regulation of vasculogenesis	ISS

MIM	HGNC	e!Ensembl
191306	6307	ENSG00000128052

P35968

Protein name

Vascular endothelial growth factor receptor 2 (VEGFR-2) (EC 2.7.10.1) (Fetal liver kinase 1) (FLK-1) (Kinase insert domain receptor) (KDR) (Protein-tyrosine kinase receptor flk-1) (CD antigen CD309)

Protein function

Tyrosine-protein kinase that acts as a cell-surface receptor for VEGFA, VEGFC and VEGFD. Plays an essential role in the regulation of angiogenesis, vascular development, vascular permeability, and embryonic hematopoiesis. Promotes proliferation,

PDB

1VR2 , 1Y6A , 1Y6B , 1YWN , 2M59 , 2MET , 2MEU , 2OH4 , 2P2H , 2P2I , 2QU5 , 2QU6 , 2RL5 , 2X1W , 2X1X , 2XIR , 3B8Q , 3B8R , 3BE2 , 3C7Q , 3CJF , 3CJG , 3CP9 , 3CPB , 3CPC , 3DTW , 3EFL , 3EWH , 3KVQ , 3S35 , 3S36 , 3S37 , 3U6J , 3V2A , 3V6B , 3VHE , 3VHK , 3VID , 3VNT , 3VO3 , 3WZD , 3WZE , 4AG8 , 4AGC , 4AGD , 4ASD , 4ASE , 5EW3 , 5OYJ , 6GQO , 6GQP

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00047	ig	229 → 321	Immunoglobulin domain	Domain
PF07679	I-set	333 → 417	Immunoglobulin I-set domain	Domain
PF13927	Ig_3	550 → 646		Domain
PF07679	I-set	667 → 754	Immunoglobulin I-set domain	Domain
PF17988	VEGFR-2_TMD	759 → 793	VEGFR-2 Transmembrane domain	Domain
PF07714	PK_Tyr_Ser-Thr	834 → 1160	Protein tyrosine and serine/threonine kinase	Domain

Tissue specificity

TISSUE SPECIFICITY: Detected in cornea (at protein level). Widely expressed. {ECO:0000269|PubMed:19668192}.

Sequence

MQSKVLLAVALWLCVETRAASVGLPSVSLDLPRLSIQKDILTIKANTTLQITCRGQRDLD
WLWPNNQSGSEQRVEVTECSDGLFCKTLTIPKVIGNDTGAYKCFYRETDLASVIYVYVQD
YRSPFIASVSDQHGVVYITENKNKTVVIPCLGSISNLNVSLCARYPEKRFVPDGNRISWD
SKKGFTIPSYMISYAGMVFCEAKINDESYQSIMYIVVVVGYRIYDVVLSPSHGIELSVGE
KLVLNCTARTELNVGIDFNWEYPSSKHQHKKLVNRDLKTQSGSEMKKFLSTLTIDGVTRS
DQGLYTCAASSGLMTKKNSTFVRVHEKPFVAFGSGMESLVEATVGERVRIPAKYLGYPPP
EIKWYKNGIPLESNHTIKAGHVLTIMEVSERDTGNYTVILTNPISKEKQSHVVSLVVYVP
PQIGEKSLISPVDSYQYGTTQTLTCTVYAIPPPHHIHWYWQLEEECANEPSQAVSVTNPY
PCEEWRSVEDFQGGNKIEVNKNQFALIEGKNKTVSTLVIQAANVSALYKCEAVNKVGRGE
RVISFHVTRGPEITLQPDMQPTEQESVSLWCTADRSTFENLTWYKLGPQPLPIHVGELPT
PVCKNLDTLWKLNATMFSNSTNDILIMELKNASLQDQGDYVCLAQDRKTKKRHCVVRQLT
VLERVAPTITGNLENQTTSIGESIEVSCTASGNPPPQIMWFKDNETLVEDSGIVLKDGNR
NLTIRRVRKEDEGLYTCQACSVLGCAKVEAFFIIEGAQEKTNLEIIILVGTAVIAMFFWL
LLVIILRTVKRANGGELKTGYLSIVMDPDELPLDEHCERLPYDASKWEFPRDRLKLGKPL
GRGAFGQVIEADAFGIDKTATCRTVAVKMLKEGATHSEHRALMSELKILIHIGHHLNVVN
LLGACTKPGGPLMVIVEFCKFGNLSTYLRSKRNEFVPYKTKGARFRQGKDYVGAIPVDLK
RRLDSITSSQSSASSGFVEEKSLSDVEEEEAPEDLYKDFLTLEHLICYSFQVAKGMEFLA
SRKCIHRDLAARNILLSEKNVVKICDFGLARDIYKDPDYVRKGDARLPLKWMAPETIFDR
VYTIQSDVWSFGVLLWEIFSLGASPYPGVKIDEEFCRRLKEGTRMRAPDYTTPEMYQTML
DCWHGEPSQRPTFSELVEHLGNLLQANAQQDGKDYIVLPISETLSMEEDSGLSLPTSPVS
CMEEEEVCDPKFHYDNTAGISQYLQNSKRKSRPVSVKTFEDIPLEEPEVKVIPDDNQTDS
GMVLASEELKTLEDRTKLSPSFGGMVPSKSRESVASEGSNQTSGYQSGYHSDDTDTTVYS
SEEAELLKLIEIGVQTGSTAQILQPDSGTTLSSPPV

Sequence length

1356

Interactions

View interactions

	KEGG		Reactome
	EGFR tyrosine kinase inhibitor resistance MAPK signaling pathway Ras signaling pathway Rap1 signaling pathway Calcium signaling pathway PI3K-Akt signaling pathway VEGF signaling pathway Focal adhesion Proteoglycans in cancer Fluid shear stress and atherosclerosis		Neurophilin interactions with VEGF and VEGFR VEGF binds to VEGFR leading to receptor dimerization Integrin cell surface interactions VEGFA-VEGFR2 Pathway VEGFR2 mediated cell proliferation Signaling by membrane-tethered fusions of PDGFRA or PDGFRB

Show/Hide Causal Diseases (3)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Capillary infantile hemangioma	Pathogenic	rs121917766	RCV000013110
Premature ovarian failure	Likely pathogenic	rs587778428	RCV001270196
Tetralogy of Fallot	Likely pathogenic	rs2545277848	RCV003985127

Show/Hide Unknown Diseases (10)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Carcinoma of colon	Uncertain significance	rs761176323, rs795939488, rs795939487, rs370501217, rs200773668, rs794729678, rs794729677, rs794729676, rs778886056, rs795939486, rs795902899, rs795902898, rs795902897, rs795902896	RCV000186529 RCV000186528 RCV000186527 RCV000186526 RCV000186520 RCV000186519 RCV000186518 RCV000186517 RCV000186516 RCV000186525 RCV000186524 RCV000186523 RCV000186522 RCV000186521
Clear cell carcinoma of kidney	Benign; Likely benign	rs56286620	RCV005889552
Hepatoblastoma	Likely benign	rs149901681	RCV001843588
High myopia	Likely benign	rs149745504	RCV000785688
Hirschsprung disease, susceptibility to, 1	Benign; Likely benign	rs34038364	RCV000201301
KDR-related disorder	Benign; Uncertain significance; Likely benign	rs1870377, rs2305948, rs56233104, rs2545269154, rs142258660, rs2110010059, rs759473733, rs772654881, rs139803589, rs192072878, rs774371518, rs56242771, rs138803814, rs201075093, rs141641290, rs56347250 View all (1 more)	RCV003975077 RCV003975078 RCV003975091 RCV003493380 RCV003924093 RCV003981391 RCV003967319 RCV003944006 RCV003919554 RCV003944780 RCV003964768 RCV003971623 RCV003965638 RCV003938253 RCV003965639 RCV003965729
Prostate cancer	Uncertain significance	rs193921127	RCV000149129
Teratoma	Uncertain significance	rs147627339	RCV003221389
Tufted angioma of skin	Uncertain significance; Likely benign	rs747477930, rs149745504	RCV003459019 RCV001849436
Uterine carcinosarcoma	Benign	rs1870377	RCV005889553

Show/Hide Text Mining Associations (350)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Actinic cheilitis	Associate	25895461
Acute Kidney Injury	Associate	34112226
Adenocarcinoma	Associate	21175993, 21751195, 26525902, 29985074
Adenoma	Associate	25372416
Airway Obstruction	Associate	26488115
Albuminuria	Stimulate	31023084
Alzheimer Disease	Associate	30576228, 37596325, 39334869
Ameloblastoma	Associate	33067558
Amyotrophic Lateral Sclerosis	Inhibit	17456229
Amyotrophic Lateral Sclerosis	Associate	40097075
Angina Stable	Associate	36435742
Anxiety	Associate	31121870
Aortic Aneurysm Thoracic	Associate	24633336
Aortic Valve Insufficiency	Associate	14760594
Aortic Valve Stenosis	Associate	39313278
Arnold Chiari Malformation	Associate	23437350
Arteriovenous Malformations	Associate	29052569
Arthritis Rheumatoid	Associate	12823854, 15593185, 17393418, 20727150, 30767867, 31405022, 31876763
Arthritis Rheumatoid	Inhibit	31876763
Ascites	Associate	19240722, 23169339
Astrocytoma	Associate	26627848, 33099473
Atherosclerosis	Associate	14990597, 22855739, 31432097
Atypical Squamous Cells of the Cervix	Associate	31535668
Autoimmune Diseases	Associate	28865413
Behcet Syndrome	Associate	29854829
Biliary Tract Neoplasms	Associate	25502982
Brain Injuries Traumatic	Associate	37418975
Breast Diseases	Associate	27881867
Breast Neoplasms	Associate	10360672, 17912247, 18715621, 18922978, 19919679, 23418605, 23832257, 24138843, 24244672, 25182240, 25377085, 25971960, 26080815, 27629739, 29699375 View all (9 more)
Breast Neoplasms	Inhibit	38189813
Calcinosis Cutis	Stimulate	21945343, 30408085
Calcinosis Cutis	Associate	22808003, 34793664
Carcinogenesis	Associate	20205278, 25895461, 27221921, 28851898, 31578580, 34358255
Carcinoid Tumor	Associate	19582519
Carcinoma	Associate	22314185, 23418605, 37185612
Carcinoma Acinar Cell	Associate	23771070
Carcinoma Adenosquamous	Associate	19563658
Carcinoma Basal Cell	Associate	33928395
Carcinoma Ductal	Associate	17239264
Carcinoma Embryonal	Associate	35778435
Carcinoma Endometrioid	Associate	18325046
Carcinoma Hepatocellular	Associate	11115828, 22554292, 23516476, 23552472, 25123269, 25978354, 28350084, 28358369, 29402992, 29739298, 30109780, 33210432, 33223512, 33673041, 35955438, 36140703 View all (1 more)
Carcinoma Hepatocellular	Stimulate	19177438
Carcinoma Hepatocellular	Inhibit	36116407
Carcinoma Large Cell	Associate	32506171, 34453496
Carcinoma Lobular	Inhibit	17239264
Carcinoma Merkel Cell	Associate	17695419, 18408656
Carcinoma Non Small Cell Lung	Associate	16849585, 19435508, 20549821, 21712447, 21724587, 24244672, 26422603, 26578684, 26853422, 28088809, 30016964, 32348765, 33656275, 34060368, 35443836 View all (6 more)
Carcinoma Ovarian Epithelial	Associate	26783205, 35144591, 37116140, 37320880
Carcinoma Renal Cell	Associate	11846206, 17465216, 17605814, 18041056, 22105611, 23192268, 23511629, 24786599, 25217984, 26021863, 26228213, 26528707, 26830973, 27144525, 27244898 View all (16 more)
Carcinoma Renal Cell	Inhibit	35834099
Carcinoma Squamous Cell	Associate	20036889, 21175993, 22355056, 24244672, 25895461, 27145277, 32993587, 34195851
Cardiomyopathies	Associate	36435742
Cardiomyopathy Dilated	Associate	17719840
Cardiovascular Diseases	Associate	36875456
Carotid Artery Diseases	Associate	26881237
Castleman Disease	Associate	35484648
Cell Transformation Neoplastic	Inhibit	32209654
Cerebral Hemorrhage	Associate	29052569
Cerebral Infarction	Stimulate	37175644
Cerebrovascular Disorders	Associate	33942489
Cholangiocarcinoma	Associate	20565817, 26014518, 28192597, 30400838
Chordoma	Associate	32011476
Clear cell metastatic renal cell carcinoma	Associate	26528707, 28963640, 35240013
Clear cell metastatic renal cell carcinoma	Inhibit	35834099
Colitis Ulcerative	Associate	12610101
Colonic Neoplasms	Associate	25372416, 25967108
Colorectal Neoplasms	Associate	15235888, 17970067, 18790786, 20205278, 20222950, 21407216, 22182247, 23146028, 23651517, 23831629, 23861747, 23905676, 25272957, 25372416, 25817288 View all (15 more)
Colorectal Neoplasms	Inhibit	29740162
Constriction Pathologic	Associate	26488115
Coronary Artery Disease	Stimulate	18929243
Coronary Artery Disease	Associate	22855739, 31432097
Coronary Disease	Associate	16139132, 17707181, 18578002, 26726843, 27175642
COVID 19	Associate	32758869, 33205351, 33246355, 34112226, 37499788
Craniopharyngioma	Associate	29952957
Crohn Disease	Associate	12610101
Crohn Disease	Stimulate	21658307
Cushing's symphalangism	Associate	37596325
Cysts	Associate	11422734
Death	Associate	21724587, 23293110, 28338114
Death Sudden	Associate	34328347
Dementia Vascular	Associate	37596325
Dental Leakage	Associate	34702368
Desmoid disease hereditary	Associate	37943631
Diabetes Gestational	Inhibit	27645229
Diabetes Gestational	Associate	28817576
Diabetes Mellitus	Inhibit	16139132, 26956185, 30321232
Diabetes Mellitus	Associate	21764240, 22474430, 24572151, 26726843, 27175642, 35778435, 36875456
Diabetes Mellitus Type 1	Associate	34267242
Diabetes Mellitus Type 2	Associate	26881237, 26956185, 33942489, 39273385
Diabetic Angiopathies	Associate	29582815
Diabetic Nephropathies	Associate	32922187, 39273385
Diabetic Neuropathies	Associate	28554530
Diabetic Retinopathy	Associate	24623964, 29058688, 29582815
Drug Related Side Effects and Adverse Reactions	Associate	12771932, 20838437, 24922514, 25157767
Drug Related Side Effects and Adverse Reactions	Stimulate	23364970
Dupuytren Contracture	Associate	23992143
Dystonic Disorders	Associate	37350195
Edema	Associate	21177802
Emphysema	Associate	31980491
Endometrial Neoplasms	Associate	16557278, 31322068, 32902840, 35241527
Endometriosis	Associate	17765237, 27453397, 8755660
Endometritis	Associate	36531509
Enterocolitis Necrotizing	Associate	31383782
Ependymoma	Associate	24190638, 32612806
Esophageal Neoplasms	Associate	32342599
Esophageal Squamous Cell Carcinoma	Associate	36921563
Fibroadenoma	Associate	26902100
Fibromatosis Aggressive	Associate	27062580
Focal Nodular Hyperplasia	Associate	30678450
Fuchs' Endothelial Dystrophy	Stimulate	32636303
Gallbladder Neoplasms	Associate	34185421
Gangrene	Associate	15531204
Gastro enteropancreatic neuroendocrine tumor	Associate	29787601
Gastrointestinal Neoplasms	Associate	21330783
Gastrointestinal Stromal Tumors	Associate	17036392
Gaucher Disease	Associate	32074519
Glaucoma Angle Closure	Associate	26988898
Glaucoma Open Angle	Associate	26988898
Glioblastoma	Associate	17504929, 21191630, 22179774, 22973019, 25501707, 27172220, 27705944, 31991805, 32074192, 33099473, 33727583, 34875133, 34997451, 35173528, 37610648, 38036978 View all (1 more)
Glioma	Associate	17189383, 17504929, 20446891, 24922514, 25758142, 25833462, 27385209, 27613831, 31486713, 32074192, 33099473, 34815785, 35545820, 8774132
Glucosephosphate Dehydrogenase Deficiency	Associate	14576053, 19008126
Glut1 Deficiency Syndrome	Associate	26993523
Glycogen Storage Disease Type II	Associate	35326447
Goiter	Associate	32074519
Goiter Nodular	Associate	16570574
Granuloma Pyogenic	Associate	31776151
Graves Disease	Associate	32074519
Hand Arm Vibration Syndrome	Associate	40460899
Hand Foot Syndrome	Associate	20630084
Hantavirus Pulmonary Syndrome	Associate	21177802
Hashimoto Disease	Associate	32074519
Head and Neck Neoplasms	Associate	15475932
Heart Defects Congenital	Associate	34313777, 34328347
Heart Failure	Associate	22519984, 27150003, 36435742
Heart Failure	Inhibit	36761158
Heart Failure Diastolic	Associate	34155850
Hemangioendothelioma	Associate	22314185
Hemangioendothelioma Epithelioid	Associate	22314185
Hemangioma	Associate	11733376, 14576053, 18814928, 18931684, 36656337
Hemangioma	Stimulate	24704994
Hemangioma Capillary	Associate	22314185, 8644848
Hemangioma capillary infantile	Associate	18931684, 23424651, 29664206
Hemangiosarcoma	Associate	20949568, 22314185, 28056866, 29855279, 31243333, 31510873, 32123305, 40474296, 8644848
Hematologic Neoplasms	Associate	12842710
Hemolytic Uremic Syndrome	Associate	22563920
Hemorrhage	Associate	21177802
Hemorrhagic Stroke	Associate	31293107
Hemorrhoids	Associate	40114371
Hepatitis B Chronic	Stimulate	23552472
Hepatitis C	Associate	23775568
Hereditary Breast and Ovarian Cancer Syndrome	Associate	26902100
Heredodegenerative Disorders Nervous System	Associate	21177802
HIV Infections	Associate	19712456
Hodgkin Disease	Associate	27365461, 35977101
Huntington Disease	Associate	32074519
Hyperglycemia	Associate	20674013, 26934556, 29351188
Hyperglycemia	Stimulate	29582815
Hyperoxia	Inhibit	19734318
Hypertension	Associate	20630084, 21882181, 31432097, 35075138
Hypoglycemia	Stimulate	25401697
Hypoplastic Left Heart Syndrome	Associate	34313777
Hypoxia	Stimulate	17273772, 18286204, 27999191
Hypoxia	Associate	17406354, 20831794, 23178531, 23788753, 27488544, 28143503, 29351188, 32506171, 33067558, 33215223, 35417854
Hypoxia	Inhibit	19244479
Hypoxia Brain	Associate	21854597, 27163696, 30723174
Idiopathic Noncirrhotic Portal Hypertension	Associate	23620752
Idiopathic Pulmonary Fibrosis	Inhibit	16936446
Idiopathic Pulmonary Fibrosis	Associate	32426915
Ige Responsiveness Atopic	Associate	17121871
Infarction Anterior Cerebral Artery	Associate	32506171
Infertility	Associate	36901702
Inflammation	Stimulate	16234362
Inflammation	Associate	25895461, 25967108, 26993523
Inflammatory Breast Neoplasms	Associate	22813402
Intracranial Aneurysm	Associate	28338184, 31096819
Intracranial Arteriosclerosis	Associate	32506171
Intracranial Arteriovenous Malformations	Associate	16820800
Intracranial Arteriovenous Malformations	Stimulate	29052569
Joint Diseases	Associate	21163925
Kidney Diseases	Associate	11499563
Kidney Failure Chronic	Associate	19197998
Kidney Neoplasms	Associate	17465216, 32413049, 36176934
Klatskin Tumor	Associate	24312291
Laryngeal Neoplasms	Associate	27075652
Leiomyoma	Associate	17036392
Leiomyosarcoma	Associate	25340839, 34321013
Leukemia	Associate	11877295, 11895790, 12917408, 21535879, 22251800, 23180012, 32782381
Leukemia Lymphocytic Chronic B Cell	Associate	14996703, 16790692, 21519633, 21979753
Leukemia Lymphocytic Chronic B Cell	Inhibit	19965686
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	19875757, 21535879, 23180012
Leukemia Myeloid Acute	Associate	16085543, 19463770, 30959925, 9058706
Liver Cirrhosis	Associate	11115828, 23552472, 33673041
Liver Diseases	Associate	18814928, 23775568
Lung Diseases	Associate	33246355
Lung Diseases Interstitial	Associate	16936446, 31980491
Lung Neoplasms	Associate	21712447, 22593690, 26578684, 26681011, 30194450, 32348765, 36459496, 37400960
Lymphangioma	Associate	11742043, 17584927, 22314185
Lymphatic Metastasis	Stimulate	15368324
Lymphatic Metastasis	Associate	25372416, 26014518, 28718364
Lymphoma	Associate	19821819, 27365461
Lymphoma Follicular	Associate	16790692
Lymphoma Large B Cell Diffuse	Associate	16790692, 17998899, 19821819, 22129133, 34219681, 37647140
Lymphoma Mantle Cell	Associate	16790692
Lymphoma Non Hodgkin	Associate	22190165, 23814017
Lymphoma T Cell	Associate	19120365
Macular Degeneration	Associate	22919317, 23559864, 26028346, 30696427, 34205419, 35326447
Macular Degeneration	Stimulate	35370941
Malaria Cerebral	Inhibit	19346372
Malignant mesenchymal tumor	Associate	22314185
Medulloblastoma	Associate	17704359, 25794107, 29377550
Melanoma	Associate	11121133, 18288398, 19188183, 20004943, 21544800, 26631613, 30791119, 34179721, 35688842, 37160315, 38615585
Meningeal Neoplasms	Associate	32711494
Meningioma	Associate	25100872
Menorrhagia	Associate	16169405, 17336974
Mesothelioma	Associate	22314185
Mesothelioma Malignant	Associate	20838437, 25514803, 27705913
Metabolic Syndrome	Associate	33582655
Mitochondrial Diseases	Associate	29921586
Mixed Tumor Malignant	Associate	22314185
Mouth Neoplasms	Associate	36708576
Moyamoya Disease	Associate	20668498, 23077562
Mucocutaneous Lymph Node Syndrome	Associate	30654760
Mucocutaneous Lymph Node Syndrome	Stimulate	34434074
Mucositis	Associate	25589620
Multiple Myeloma	Associate	15618473
Multiple Sclerosis	Associate	28865413
Myelodysplastic Syndromes	Associate	12100142, 25472472
Myocardial Infarction	Associate	31432097
Myositis Ossificans	Inhibit	26626181
Myxoma	Associate	15118294
Negative rheumatoid factor polyarthritis	Associate	22855739
Neoplasm Invasiveness	Associate	23250775, 37307530
Neoplasm Metastasis	Associate	16780590, 17465216, 19141404, 19563658, 25372416, 27535973, 29402992, 30423986, 30429477, 31200683, 31578580, 32348765, 33722295, 34358255, 35220896, 37591783 View all (1 more)
Neoplasm Metastasis	Inhibit	17970067
Neoplasm Metastasis	Stimulate	20004943, 20544684, 32668608
Neoplasms	Associate	10487612, 10594750, 10595926, 10799512, 11141500, 11330643, 11846206, 12368197, 15107801, 15118294, 15235888, 15333659, 15368324, 15475932, 15500293 View all (158 more)
Neoplasms	Stimulate	10748050, 19816005, 22245726, 23785399, 26902100, 32636303
Neoplasms	Inhibit	17970067, 25182240, 30016964, 34453496, 37116140
Neoplasms Germ Cell and Embryonal	Associate	20551952, 25085632
Neoplasms Squamous Cell	Associate	35313079
Nephrosis congenital	Associate	22038228
Nephrotic Syndrome	Associate	22038228
Neural Tube Defects	Associate	35778435
Neurilemmoma	Associate	17036392
Neuroblastoma	Associate	11815985, 18178312, 19141404, 21472456
Neuroectodermal Tumors	Associate	37160315
Neurofibroma Plexiform	Associate	21703400
Neurofibrosarcoma	Associate	20686603
Obesity	Associate	25630869
Obesity Maternal	Associate	27645229
Osteoarthritis	Associate	31257478
Osteosarcoma	Associate	28837148
Ovarian Diseases	Associate	39754905
Ovarian Hyperstimulation Syndrome	Associate	22587628, 24851136, 24886133
Ovarian Neoplasms	Associate	15368324, 20334653, 21574104, 28291391, 31200683, 33235818, 33713666, 37116140
Pancreatic Neoplasms	Associate	15476280, 20367641, 21263190, 23293110, 24633336, 28218664, 28338114, 33062039, 34274912
Pancreatitis	Associate	28218664
Papillomavirus Infections	Associate	31437519
Paraganglioma	Associate	35800185
Parathyroid Neoplasms	Associate	30373905
Parotid Neoplasms	Associate	29521047
Pericardial Effusion	Associate	28056866
Periodontitis	Associate	25630869
Peripheral Arterial Disease	Associate	20382861
Peritonitis	Associate	15368324, 22563920
Peritonitis	Inhibit	23585849
Persistent Fetal Circulation Syndrome	Associate	34315444
Personality Disorders	Associate	33099473
Phenylketonurias	Associate	31980491
Pheochromocytoma	Associate	12368197, 24675699
Philadelphia Chromosome	Associate	21535879, 23180012
Pituitary Neoplasms	Associate	24222652, 27438154, 37803932
Pneumonia	Associate	26993523
Pneumonia Aspiration	Associate	12668796
Post Infectious Disorders	Associate	31243333
Pre Eclampsia	Associate	19881969, 29940621
Precancerous Conditions	Associate	35313079
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	17638851
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	12100142, 17107349
Preeclamptic toxemia	Inhibit	19881969, 29172779
Preeclamptic toxemia	Associate	27199113
Pregnancy in Diabetics	Associate	33405003
Primary Ovarian Insufficiency	Associate	31692519
Prolactinoma	Associate	27438154
Prostatic Diseases	Associate	28143503
Prostatic Hyperplasia	Associate	11330643
Prostatic Neoplasms	Associate	15500293, 19908237, 25261665, 26337470
Prostatic Neoplasms Castration Resistant	Associate	24788563
Prostatitis	Associate	10660600, 28143503
Proteinuria	Associate	26274923
Psychological Distress	Associate	31121870
Pulmonary Arterial Hypertension	Associate	31980491
Pulmonary Disease Chronic Obstructive	Associate	15681497, 27163696
Rectal Neoplasms	Stimulate	25532759
Renal Insufficiency	Associate	36901702
Respiratory Distress Syndrome	Stimulate	19327291
Respiratory Insufficiency	Associate	26488115
Retinal Diseases	Associate	29058688
Retinal Vein Occlusion	Associate	35370941
Retinoblastoma	Associate	20860824, 22457763, 26619025
Sarcoma	Associate	16101185, 26646755, 27771610, 34939467
Sarcoma Ewing	Associate	27077911
Sarcoma Kaposi	Associate	10594750, 15800227, 22314185, 8644848, 9621077
Sarcoma Kaposi	Stimulate	10623771
Sarcoma Synovial	Associate	22314185
Schizophrenia	Associate	28117656
Sclerosis	Associate	29236566
Severe Dengue	Associate	17151115
Shwachman Diamond Syndrome	Associate	32908229
Sjogren's Syndrome	Stimulate	24772480
Skin Diseases	Associate	27713170
Small Cell Lung Carcinoma	Associate	37390276
Solitary Fibrous Tumors	Associate	40660115
Spinal Cord Injuries	Associate	24968203
Squamous Cell Carcinoma of Head and Neck	Associate	15475932, 20032607, 20498643, 22203933, 25612142, 26683928, 27221921, 27681865, 28718364, 32113465, 35220896, 36708576, 37341071
Stomach Neoplasms	Associate	12174363, 12439912, 17659711, 22808003, 23364970, 23422754, 27623234, 30087428, 30380970, 32070411, 32964029, 35008821, 35417854, 37591783
Stomach Neoplasms	Stimulate	28832082
Stomach Ulcer	Associate	23620752
Stroke	Associate	32506171
Synovitis	Associate	20668498
Systemic Vasculitis	Associate	26475131
Tachycardia Atrioventricular Nodal Reentry	Associate	16780590
Telangiectasia Hereditary Hemorrhagic	Associate	33894400
Teratoma	Associate	37160315
Tertiary Lymphoid Structures	Stimulate	22203933
Tetralogy of Fallot	Associate	30232381, 34328347
Thrombocytopenia	Associate	23620752
Thrombosis	Associate	25123269
Thymic epithelial tumor	Associate	24908332
Thymus Neoplasms	Associate	26254278
Thyroid cancer follicular	Associate	25971967
Thyroid cancer medullary	Associate	20368568
Thyroid Cancer Papillary	Associate	16570574, 30678450, 32047817
Thyroid Carcinoma Anaplastic	Associate	29615459
Thyroid Diseases	Associate	17696908
Thyroid Neoplasms	Associate	29615459, 30272326
Thyroid Neoplasms	Stimulate	34077013, 35313079
Thyroid Nodule	Associate	31535668
Triple Negative Breast Neoplasms	Stimulate	25025175, 31079851
Trophoblastic Neoplasms	Associate	33405003
Tuberous Sclerosis	Associate	21767323
Ulcer	Associate	15531204
Urinary Bladder Neoplasms	Associate	16780590, 21529900, 23251617, 30816487, 31665050, 36982218
Uterine Cervical Neoplasms	Associate	21175993, 21424032, 28072723, 34011535, 34544526
Varicose Veins	Associate	14760594
Vascular Diseases	Associate	14990597, 24316428
Vascular Malformation Primary Intraosseous	Associate	32113465
Vohwinkel Syndrome Variant Form	Associate	20236940
X Linked Combined Immunodeficiency Diseases	Associate	25272957

KDR (kinase insert domain receptor)