Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	3790
Gene name Gene Name - the full gene name approved by the HGNC.	Potassium voltage-gated channel modifier subfamily S member 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	KCNS3
Synonyms (NCBI Gene) Gene synonyms aliases	KV9.3
Chromosome Chromosome number	2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	2p24.2
Summary Summary of gene provided in NCBI Entrez Gene.	Voltage-gated potassium channels form the largest and most diversified class of ion channels and are present in both excitable and nonexcitable cells. Their main functions are associated with the regulation of the resting membrane potential and the contro

Show/Hide all(18)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005009	hsa-miR-125b-5p	Microarray	17891175
MIRT022698	hsa-miR-124-3p	Microarray	18668037
MIRT024380	hsa-miR-215-5p	Microarray	19074876
MIRT026551	hsa-miR-192-5p	Microarray	19074876
MIRT1082462	hsa-miR-192	CLIP-seq
MIRT1082463	hsa-miR-215	CLIP-seq
MIRT1082464	hsa-miR-3646	CLIP-seq
MIRT1082465	hsa-miR-3919	CLIP-seq
MIRT1082466	hsa-miR-4269	CLIP-seq
MIRT2020521	hsa-miR-223	CLIP-seq
MIRT2020522	hsa-miR-3130-3p	CLIP-seq
MIRT2020523	hsa-miR-3908	CLIP-seq
MIRT2020524	hsa-miR-3942-3p	CLIP-seq
MIRT2020525	hsa-miR-4291	CLIP-seq
MIRT2020526	hsa-miR-4697-3p	CLIP-seq
MIRT2020527	hsa-miR-545	CLIP-seq
MIRT2020525	hsa-miR-4291	CLIP-seq
MIRT2020527	hsa-miR-545	CLIP-seq

Show/Hide all(14)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005249	Function	Voltage-gated potassium channel activity	IBA	21873635
GO:0005251	Function	Delayed rectifier potassium channel activity	TAS	10484328
GO:0005794	Component	Golgi apparatus	IDA
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	TAS
GO:0006813	Process	Potassium ion transport	TAS	10484328
GO:0008076	Component	Voltage-gated potassium channel complex	IBA	21873635
GO:0015459	Function	Potassium channel regulator activity	TAS	10484328
GO:0016021	Component	Integral component of membrane	IBA	21873635
GO:0034765	Process	Regulation of ion transmembrane transport	IEA
GO:0050796	Process	Regulation of insulin secretion	TAS
GO:0051260	Process	Protein homooligomerization	IEA
GO:0071805	Process	Potassium ion transmembrane transport	IBA	21873635

MIM	HGNC	e!Ensembl
603888	6302	ENSG00000170745

Protein

UniProt ID

Q9BQ31

Protein name

Delayed-rectifier potassium channel regulatory subunit KCNS3 (Delayed-rectifier K(+) channel alpha subunit 3) (Delayed-rectifier potassium channel subunit Kv9.3) (Kv9.3) (Potassium voltage-gated channel subfamily S member 3)

Protein function

Potassium channel regulatory subunit that modulates the delayed rectifier potassium channel activity of KCNB1 by namely slowing down the deactivation and inactivation time constants (PubMed:10484328). While it does not form functional channel on

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02214	BTB_2	17 → 116	BTB/POZ domain	Domain
PF00520	Ion_trans	184 → 417	Ion transport protein	Family

Tissue specificity

TISSUE SPECIFICITY: Detected in whole normal term placental and placental chorionic plate arteries and veins. Detected in syncytiotrophoblast and in blood vessel endothelium within intermediate villi and chorionic plate (at protein level) (PubMed:22943705

Sequence

MVFGEFFHRPGQDEELVNLNVGGFKQSVDQSTLLRFPHTRLGKLLTCHSEEAILELCDDY
SVADKEYYFDRNPSLFRYVLNFYYTGKLHVMEELCVFSFCQEIEYWGINELFIDSCCSNR
YQERKEENHEKDWDQKSHDVSTDSSFEESSLFEKELEKFDTLRFGQLRKKIWIRMENPAY
CLSAKLIAISSLSVVLASIVAMCVHSMSEFQNEDGEVDDPVLEGVEIACIAWFTGELAVR
LAAAPCQKKFWKNPLNIIDFVSIIPFYATLAVDTKEEESEDIENMGKVVQILRLMRIFRI
LKLARHSVGLRSLGATLRHSYHEVGLLLLFLSVGISIFSVLIYSVEKDDHTSSLTSIPIC
WWWATISMTTVGYGDTHPVTLAGKLIASTCIICGILVVALPITIIFNKFSKYYQKQKDID
VDQCSEDAPEKCHELPYFNIRDIYAQRMHTFITSLSSVGIVVSDPDSTDASSIEDNEDIC
NTTSLENCTAK

Sequence length

491

Interactions

View interactions

	Reactome
			Voltage gated Potassium channels Glucagon-like Peptide-1 (GLP1) regulates insulin secretion

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Schizophrenia	Schizophrenia	rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346 View all (12 more)	24170294

Show/Hide Unknown Diseases (8)

Disease term	Disease name	Evidence	Source
Unknown
Coenzyme Q10 Deficiency	Coenzyme Q10 Deficiency		GWAS
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis		GWAS
Gout	Gout		GWAS
Diabetes	Diabetes		GWAS
Ovarian cancer	Ovarian cancer	Conditional KD of IL6 in the OCCA xenograft model delays tumor growth	GWAS, CBGDA
Breast Cancer	Breast Cancer	Importantly, breast cancer patients bearing PRC2 LOF mutations displayed significantly worse prognosis compared with PRC2 wild-type patients	GWAS, CBGDA
Colorectal Cancer	Colorectal Cancer	In summary, our data strongly demonstrated that upregulation of GRB7 conferred MEKi resistance in CRC cells with KRAS mutations by mediating RTK signaling through the recruitment of PLK1.	GWAS, CBGDA
Oligodendroglioma	Oligodendroglioma		GWAS

Show/Hide Text Mining Associations (2)

Disease Name	Relationship Type	References
Associations from Text Mining
Lung Diseases	Associate	26635082
Pulmonary Arterial Hypertension	Associate	34349187

KCNS3 (potassium voltage-gated channel modifier subfamily S member 3)