Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
378884
Gene name Gene Name - the full gene name approved by the HGNC.
NHL repeat containing E3 ubiquitin protein ligase 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
NHLRC1
Synonyms (NCBI Gene) Gene synonyms aliases
EPM2A, EPM2B, MALIN, MELF2, bA204B7.2
Disease Acronyms (UniProt) Disease acronyms from UniProt database
MELF2
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6p22.3
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a single subunit E3 ubiquitin ligase. Laforin is polyubiquitinated by the encoded protein. Defects in this intronless gene lead to an accumulation of laforin and onset of Lafora disease, also known as progressive myoclo
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs28940575 A>T Pathogenic Missense variant, coding sequence variant
rs28940576 G>C Pathogenic Missense variant, coding sequence variant
rs121917875 G>A,C,T Pathogenic Missense variant, stop gained, coding sequence variant, synonymous variant
rs121917876 A>T Pathogenic Missense variant, coding sequence variant
rs137852859 T>G Pathogenic Missense variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT1184312 hsa-miR-101 CLIP-seq
MIRT1184313 hsa-miR-1285 CLIP-seq
MIRT1184314 hsa-miR-151-5p CLIP-seq
MIRT1184315 hsa-miR-151b CLIP-seq
MIRT1184316 hsa-miR-224 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000209 Process Protein polyubiquitination IBA 21873635
GO:0000209 Process Protein polyubiquitination IDA 15930137
GO:0004842 Function Ubiquitin-protein transferase activity EXP 15930137
GO:0004842 Function Ubiquitin-protein transferase activity IDA 15930137, 18070875
GO:0005515 Function Protein binding IPI 15930137, 17908927, 21505799, 22578008, 22961547
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
608072 21576 ENSG00000187566
Protein
UniProt ID Q6VVB1
Protein name E3 ubiquitin-protein ligase NHLRC1 (EC 2.3.2.27) (Malin) (NHL repeat-containing protein 1) (RING-type E3 ubiquitin transferase NHLRC1)
Protein function E3 ubiquitin-protein ligase. Together with the phosphatase EPM2A/laforin, appears to be involved in the clearance of toxic polyglucosan and protein aggregates via multiple pathways. In complex with EPM2A/laforin and HSP70, suppresses the cellula
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF14634 zf-RING_5 25 73 zinc-RING finger domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in brain, cerebellum, spinal cord, medulla, heart, liver, skeletal muscle and pancreas. {ECO:0000269|PubMed:12958597}.
Sequence
MAAEASESGPALHELMREAEISLLECKVCFEKFGHRQQRRPRNLSCGHVVCLACVAALAH
PRTLALECPFCRR
ACRGCDTSDCLPVLHLIELLGSALRQSPAAHRAAPSAPGALTCHHTF
GGWGTLVNPTGLALCPKTGRVVVVHDGRRRVKIFDSGGGCAHQFGEKGDAAQDIRYPVDV
TITNDCHVVVTDAGDRSIKVFDFFGQIKLVIGGQFSLPWGVETTPQNGIVVTDAEAGSLH
LLDVDFAEGVLRRTERLQAHLCNPRGVAVSWLTGAIAVLEHPLALGTGVCSTRVKVFSSS
MQLVGQVDTFGLSLYFPSKITASAVTFDHQGNVIVADTSGPAILCLGKPEEFPVPKPMVT
HGLSHPVALTFTKENSLLVLDTASHSIKVYKVDWG
Sequence length 395
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Ubiquitin mediated proteolysis   Glycogen synthesis
Myoclonic epilepsy of Lafora
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Action myoclonus-renal failure syndrome Action Myoclonus-Renal Failure Syndrome rs727502772, rs727502773, rs121909118, rs121909119, rs727502781, rs727502782, rs200053119, rs886041078, rs886041077, rs886041076, rs886041075, rs995674389, rs1553948516, rs1578733075 25401298
Apraxia Apraxias rs121908377, rs121908378, rs1135401820, rs1178491246, rs1584969672
Dentatorubral pallidoluysian atrophy Dentatorubral-Pallidoluysian Atrophy rs60216939 25401298
Glycogen storage disease Glycogen Storage Disease rs10250779, rs387906244, rs113994126, rs113994129, rs113994134, rs369973784, rs199922945, rs118203964, rs113994132, rs387906246, rs113994128, rs267606639, rs267606640, rs755419857, rs895690691
View all (721 more)
Unknown
Disease term Disease name Evidence References Source
Absence seizure Atypical absence seizure ClinVar
Mental depression Depressive disorder ClinVar
Psoriasis Psoriasis GWAS
Associations from Text Mining
Disease Name Relationship Type References
Death Associate 16529633
Epilepsies Myoclonic Associate 35569391
Headache Disorders Associate 16529633
Lafora Disease Associate 12960212, 15781812, 15930137, 16190947, 16529633, 16950819, 17452581, 19322595, 19744044, 20738377, 21728993, 21887368, 22223637, 22961547, 25270369
View all (9 more)
Lung Neoplasms Associate 36142605
Neurodegenerative Diseases Associate 15930137