CATSPER4 (cation channel sperm associated 4)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
378807
Gene name Gene Name - the full gene name approved by the HGNC.
Cation channel sperm associated 4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CATSPER4
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1p36.11
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(192)
miRTarBase ID miRNA Experiments Reference
MIRT609580 hsa-miR-5586-5p HITS-CLIP 23824327
MIRT609579 hsa-miR-5196-3p HITS-CLIP 23824327
MIRT609578 hsa-miR-4530 HITS-CLIP 23824327
MIRT609577 hsa-miR-338-3p HITS-CLIP 23824327
MIRT609576 hsa-miR-5193 HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(16)
GO ID Ontology Definition Evidence Reference
GO:0001669 Component Acrosomal vesicle IBA 21873635
GO:0005227 Function Calcium activated cation channel activity IEA
GO:0005245 Function Voltage-gated calcium channel activity IBA 21873635
GO:0005515 Function Protein binding IPI 32296183
GO:0005886 Component Plasma membrane TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
609121 23220 ENSG00000188782
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Q7RTX7
Protein name Cation channel sperm-associated protein 4 (CatSper4)
Protein function Pore-forming subunit of the CatSper complex, a sperm-specific voltage-gated calcium channel that plays a central role in calcium-dependent physiological responses essential for successful fertilization, such as sperm hyperactivation, acrosome re
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00520 Ion_trans 91 → 318 Ion transport protein Family
Tissue specificity TISSUE SPECIFICITY: Testis-specific. {ECO:0000269|PubMed:12932298, ECO:0000269|PubMed:17347248}.
Sequence 
MRDNEKAWWQQWTSHTGLEGWGGTQEDRMGFGGAVAALRGRPSPLQSTIHESYGRPEEQV
LINRQEITNKADAWDMQEFITHMYIKQLLRHPAFQLLLALLLVINAITIALRTNSYLDQK
HYELFSTIDDIVLTILLCEVLLGWLNGFWIFWKDGWNILNFIIVFILLLRFFINEINIPS
INYTLRALRLVHVCMAVEPLARIIRVILQSVPDMANIMVLILFFMLVFSVFGVTLFGAFV
PKHFQNIQVALYTLFICITQDGWVDIYSDFQTEKREYAMEIGGAIYFTIFITIGAFIGIN
LFVIVVTTNLEQMMKAGEQGQQQRITFSETGAEEEEENDQLPLVHCVVARSEKSGLLQEP
LAGGPLSNLSENTCDNFCLVLEAIQENLRQYKEIRDELNMIVEEVRAIRFNQEQESEVLN
RRSSTSGSLETTSSKDIRQMSQQQDLLSALVSMEKVHDSSSQILLKKHKSSH
Sequence length 472
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  Reactome
    Sperm Motility And Taxes
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Narcolepsy Narcolepsy rs104894574, rs387906655 19629137