Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
3782
Gene name Gene Name - the full gene name approved by the HGNC.
Potassium calcium-activated channel subfamily N member 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
KCNN3
Synonyms (NCBI Gene) Gene synonyms aliases
KCa2.3, SK3, SKCA3, ZLS3, hSK3
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1q21.3
Summary Summary of gene provided in NCBI Entrez Gene.
Action potentials in vertebrate neurons are followed by an afterhyperpolarization (AHP) that may persist for several seconds and may have profound consequences for the firing pattern of the neuron. Each component of the AHP is kinetically distinct and is
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs1571259807 T>A Pathogenic Coding sequence variant, missense variant
rs1571260285 C>T Pathogenic Coding sequence variant, missense variant
rs1571353663 T>C Pathogenic Coding sequence variant, genic upstream transcript variant, upstream transcript variant, missense variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT612837 hsa-miR-622 HITS-CLIP 19536157
MIRT612836 hsa-miR-3920 HITS-CLIP 19536157
MIRT612835 hsa-miR-29a-5p HITS-CLIP 19536157
MIRT612832 hsa-miR-30a-3p HITS-CLIP 19536157
MIRT612831 hsa-miR-30d-3p HITS-CLIP 19536157
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005242 Function Inward rectifier potassium channel activity IDA 12382077
GO:0005242 Function Inward rectifier potassium channel activity IEA
GO:0005515 Function Protein binding IPI 32296183
GO:0005516 Function Calmodulin binding IBA
GO:0005516 Function Calmodulin binding IDA 31155282
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
602983 6292 ENSG00000143603
Protein
UniProt ID Q9UGI6
Protein name Small conductance calcium-activated potassium channel protein 3 (SK3) (SKCa 3) (SKCa3) (KCa2.3)
Protein function Small conductance calcium-activated potassium channel that mediates the voltage-independent transmembrane transfer of potassium across the cell membrane through a constitutive interaction with calmodulin which binds the intracellular calcium all
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF03530 SK_channel 269 382 Calcium-activated SK potassium channel Family
PF07885 Ion_trans_2 461 547 Ion channel Family
PF02888 CaMBD 561 635 Calmodulin binding domain Family
Tissue specificity TISSUE SPECIFICITY: [Isoform 3]: Widely distributed in human tissues and is present at 20-60% of KCNN3 in the brain. {ECO:0000269|PubMed:12808432}.
Sequence
MDTSGHFHDSGVGDLDEDPKCPCPSSGDEQQQQQQQQQQQQPPPPAPPAAPQQPLGPSLQ
PQPPQLQQQQQQQQQQQQQQPPHPLSQLAQLQSQPVHPGLLHSSPTAFRAPPSSNSTAIL
HPSSRQGSQLNLNDHLLGHSPSSTATSGPGGGSRHRQASPLVHRRDSNPFTEIAMSSCKY
SGGVMKPLSRLSASRRNLIEAETEGQPLQLFSPSNPPEIVISSREDNHAHQTLLHHPNAT
HNHQHAGTTASSTTFPKANKRKNQNIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVI
ETELSWGLYSKDSMFSLALKCLISLSTIILLGLIIAYHTREVQLFVIDNGADDWRIAMTY
ERILYISLEMLVCAIHPIPGEY
KFFWTARLAFSYTPSRAEADVDIILSIPMFLRLYLIAR
VMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRV
CERYHDQQDVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTALVVA
VVARKLE
LTKAEKHVHNFMMDTQLTKRIKNAAANVLRETWLIYKHTKLLKKIDHAKVRKH
QRKFLQAIHQLRSVKMEQRKLSDQANTLVDLSKMQ
NVMYDLITELNDRSEDLEKQIGSLE
SKLEHLTASFNSLPLLIADTLRQQQQQLLSAIIEARGVSVAVGTTHTPISDSPIGVSSTS
FPTPYTSSSSC
Sequence length 731
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Insulin secretion
GnRH secretion
  Ca2+ activated K+ channels
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Zimmerman Laband Syndrome Zimmermann-laband syndrome 3 rs1571259807, rs1571353663, rs1571260285 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Atrial Fibrillation Atrial fibrillation N/A N/A GWAS
Bipolar Disorder Bipolar disorder N/A N/A GWAS
Cholelithiasis Cholelithiasis N/A N/A GWAS
Dyslexia Dyslexia N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Abortion Habitual Associate 39299134
Atrial Fibrillation Associate 20173747, 21107608, 22019810, 22384221, 22726630, 23428961, 24910551, 26272656, 28175276, 28381281, 29624624, 31152482, 33350184
Atrial Fibrillation Stimulate 30664154
Breast Neoplasms Associate 20955368, 26619845
Cardiomyopathies Associate 26710323
Cardiomyopathy Dilated Associate 26710323
Channelopathies Associate 33594261, 35030515
Cholangiocarcinoma Associate 29408647
Ciliary Motility Disorders Associate 24824133
COVID 19 Associate 36104591