Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	3760
Gene name Gene Name - the full gene name approved by the HGNC.	Potassium inwardly rectifying channel subfamily J member 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	KCNJ3
Synonyms (NCBI Gene) Gene synonyms aliases	GIRK1, KGA, KIR3.1
Chromosome Chromosome number	2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	2q24.1
Summary Summary of gene provided in NCBI Entrez Gene.	Potassium channels are present in most mammalian cells, where they participate in a wide range of physiologic responses. The protein encoded by this gene is an integral membrane protein and inward-rectifier type potassium channel. The encoded protein, whi

Show/Hide all(138)

miRTarBase ID	miRNA	Experiments	Reference
MIRT506909	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT506908	hsa-miR-511-3p	HITS-CLIP	21572407
MIRT506907	hsa-miR-567	HITS-CLIP	21572407
MIRT506906	hsa-miR-223-5p	HITS-CLIP	21572407
MIRT522897	hsa-miR-6867-5p	HITS-CLIP	21572407
MIRT506905	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT506904	hsa-miR-3924	HITS-CLIP	21572407
MIRT506903	hsa-miR-297	HITS-CLIP	21572407
MIRT506902	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT506909	hsa-miR-5011-5p	PAR-CLIP	20371350
MIRT506908	hsa-miR-511-3p	PAR-CLIP	20371350
MIRT506906	hsa-miR-223-5p	PAR-CLIP	20371350
MIRT522897	hsa-miR-6867-5p	PAR-CLIP	20371350
MIRT506905	hsa-miR-190a-3p	PAR-CLIP	20371350
MIRT506904	hsa-miR-3924	PAR-CLIP	20371350
MIRT506902	hsa-miR-1277-5p	PAR-CLIP	20371350
MIRT522899	hsa-miR-361-5p	PAR-CLIP	21572407
MIRT506902	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT556831	hsa-miR-8485	PAR-CLIP	21572407
MIRT556830	hsa-miR-329-3p	PAR-CLIP	21572407
MIRT556829	hsa-miR-362-3p	PAR-CLIP	21572407
MIRT556828	hsa-miR-603	PAR-CLIP	21572407
MIRT506909	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT522898	hsa-miR-2115-3p	PAR-CLIP	21572407
MIRT506908	hsa-miR-511-3p	PAR-CLIP	21572407
MIRT506907	hsa-miR-567	PAR-CLIP	21572407
MIRT506906	hsa-miR-223-5p	PAR-CLIP	21572407
MIRT522897	hsa-miR-6867-5p	PAR-CLIP	21572407
MIRT556827	hsa-miR-3941	PAR-CLIP	21572407
MIRT506905	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT506904	hsa-miR-3924	PAR-CLIP	21572407
MIRT506903	hsa-miR-297	PAR-CLIP	21572407
MIRT522896	hsa-miR-374a-3p	PAR-CLIP	21572407
MIRT522899	hsa-miR-361-5p	PAR-CLIP	23446348
MIRT506902	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT506909	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT522898	hsa-miR-2115-3p	PAR-CLIP	23446348
MIRT506908	hsa-miR-511-3p	PAR-CLIP	23446348
MIRT506907	hsa-miR-567	PAR-CLIP	23446348
MIRT506906	hsa-miR-223-5p	PAR-CLIP	23446348
MIRT522897	hsa-miR-6867-5p	PAR-CLIP	23446348
MIRT506905	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT506904	hsa-miR-3924	PAR-CLIP	23446348
MIRT506903	hsa-miR-297	PAR-CLIP	23446348
MIRT522896	hsa-miR-374a-3p	PAR-CLIP	23446348
MIRT506909	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT506908	hsa-miR-511-3p	PAR-CLIP	23446348
MIRT506907	hsa-miR-567	PAR-CLIP	23446348
MIRT506906	hsa-miR-223-5p	PAR-CLIP	23446348
MIRT506905	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT506904	hsa-miR-3924	PAR-CLIP	23446348
MIRT506903	hsa-miR-297	PAR-CLIP	23446348
MIRT506902	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT506909	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT506908	hsa-miR-511-3p	HITS-CLIP	21572407
MIRT506907	hsa-miR-567	HITS-CLIP	21572407
MIRT506906	hsa-miR-223-5p	HITS-CLIP	21572407
MIRT522897	hsa-miR-6867-5p	HITS-CLIP	21572407
MIRT506905	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT506904	hsa-miR-3924	HITS-CLIP	21572407
MIRT506903	hsa-miR-297	HITS-CLIP	21572407
MIRT506902	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT506909	hsa-miR-5011-5p	PAR-CLIP	20371350
MIRT506908	hsa-miR-511-3p	PAR-CLIP	20371350
MIRT506906	hsa-miR-223-5p	PAR-CLIP	20371350
MIRT522897	hsa-miR-6867-5p	PAR-CLIP	20371350
MIRT506905	hsa-miR-190a-3p	PAR-CLIP	20371350
MIRT506904	hsa-miR-3924	PAR-CLIP	20371350
MIRT506902	hsa-miR-1277-5p	PAR-CLIP	20371350
MIRT522899	hsa-miR-361-5p	PAR-CLIP	21572407
MIRT506902	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT556831	hsa-miR-8485	PAR-CLIP	21572407
MIRT556830	hsa-miR-329-3p	PAR-CLIP	21572407
MIRT556829	hsa-miR-362-3p	PAR-CLIP	21572407
MIRT556828	hsa-miR-603	PAR-CLIP	21572407
MIRT506909	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT522898	hsa-miR-2115-3p	PAR-CLIP	21572407
MIRT506908	hsa-miR-511-3p	PAR-CLIP	21572407
MIRT506907	hsa-miR-567	PAR-CLIP	21572407
MIRT506906	hsa-miR-223-5p	PAR-CLIP	21572407
MIRT522897	hsa-miR-6867-5p	PAR-CLIP	21572407
MIRT556827	hsa-miR-3941	PAR-CLIP	21572407
MIRT506905	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT506904	hsa-miR-3924	PAR-CLIP	21572407
MIRT506903	hsa-miR-297	PAR-CLIP	21572407
MIRT522896	hsa-miR-374a-3p	PAR-CLIP	21572407
MIRT522899	hsa-miR-361-5p	PAR-CLIP	23446348
MIRT506902	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT506909	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT522898	hsa-miR-2115-3p	PAR-CLIP	23446348
MIRT506908	hsa-miR-511-3p	PAR-CLIP	23446348
MIRT506907	hsa-miR-567	PAR-CLIP	23446348
MIRT506906	hsa-miR-223-5p	PAR-CLIP	23446348
MIRT522897	hsa-miR-6867-5p	PAR-CLIP	23446348
MIRT506905	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT506904	hsa-miR-3924	PAR-CLIP	23446348
MIRT506903	hsa-miR-297	PAR-CLIP	23446348
MIRT522896	hsa-miR-374a-3p	PAR-CLIP	23446348
MIRT506909	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT506908	hsa-miR-511-3p	PAR-CLIP	23446348
MIRT506907	hsa-miR-567	PAR-CLIP	23446348
MIRT506906	hsa-miR-223-5p	PAR-CLIP	23446348
MIRT506905	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT506904	hsa-miR-3924	PAR-CLIP	23446348
MIRT506903	hsa-miR-297	PAR-CLIP	23446348
MIRT506902	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT1081535	hsa-miR-410	CLIP-seq
MIRT1081536	hsa-miR-4270	CLIP-seq
MIRT1081537	hsa-miR-4441	CLIP-seq
MIRT2020200	hsa-miR-300	CLIP-seq
MIRT2020201	hsa-miR-3180-5p	CLIP-seq
MIRT2020202	hsa-miR-381	CLIP-seq
MIRT2020203	hsa-miR-4328	CLIP-seq
MIRT2020204	hsa-miR-4666-3p	CLIP-seq
MIRT2020205	hsa-miR-510	CLIP-seq
MIRT2020206	hsa-miR-512-5p	CLIP-seq
MIRT2020207	hsa-miR-520a-5p	CLIP-seq
MIRT2020208	hsa-miR-525-5p	CLIP-seq
MIRT2452210	hsa-miR-142-5p	CLIP-seq
MIRT2452211	hsa-miR-30a	CLIP-seq
MIRT2452212	hsa-miR-30b	CLIP-seq
MIRT2452213	hsa-miR-30c	CLIP-seq
MIRT2452214	hsa-miR-30d	CLIP-seq
MIRT2452215	hsa-miR-30e	CLIP-seq
MIRT2452216	hsa-miR-548a-5p	CLIP-seq
MIRT2452217	hsa-miR-548ab	CLIP-seq
MIRT2452218	hsa-miR-548ak	CLIP-seq
MIRT2452219	hsa-miR-548b-5p	CLIP-seq
MIRT2452220	hsa-miR-548c-5p	CLIP-seq
MIRT2452221	hsa-miR-548d-5p	CLIP-seq
MIRT2452222	hsa-miR-548h	CLIP-seq
MIRT2452223	hsa-miR-548i	CLIP-seq
MIRT2452224	hsa-miR-548j	CLIP-seq
MIRT2452225	hsa-miR-548k	CLIP-seq
MIRT2452226	hsa-miR-548l	CLIP-seq
MIRT2452227	hsa-miR-548w	CLIP-seq
MIRT2452228	hsa-miR-548y	CLIP-seq
MIRT2452229	hsa-miR-559	CLIP-seq

Show/Hide all(21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005242	Function	Inward rectifier potassium channel activity	IDA	12297500, 20560207
GO:0005515	Function	Protein binding	IPI	12297500
GO:0005886	Component	Plasma membrane	IBA	21873635
GO:0005886	Component	Plasma membrane	TAS
GO:0006813	Process	Potassium ion transport	TAS	8804710
GO:0008076	Component	Voltage-gated potassium channel complex	IDA	20560207
GO:0009897	Component	External side of plasma membrane	IEA
GO:0015467	Function	G-protein activated inward rectifier potassium channel activity	IEA
GO:0030315	Component	T-tubule	IEA
GO:0034765	Process	Regulation of ion transmembrane transport	IBA	21873635
GO:0051602	Process	Response to electrical stimulus	IEA
GO:0086089	Function	Voltage-gated potassium channel activity involved in atrial cardiac muscle cell action potential repolarization	IC	20560207
GO:0086091	Process	Regulation of heart rate by cardiac conduction	IC	20560207
GO:0098688	Component	Parallel fiber to Purkinje cell synapse	IEA
GO:0098914	Process	Membrane repolarization during atrial cardiac muscle cell action potential	IC	20560207
GO:0098915	Process	Membrane repolarization during ventricular cardiac muscle cell action potential	IEA
GO:0099056	Component	Integral component of presynaptic membrane	IEA
GO:0099625	Process	Ventricular cardiac muscle cell membrane repolarization	IC	20560207
GO:1902282	Function	Voltage-gated potassium channel activity involved in ventricular cardiac muscle cell action potential repolarization	IC	20560207
GO:1990573	Process	Potassium ion import across plasma membrane	IBA	21873635
GO:1990573	Process	Potassium ion import across plasma membrane	IDA	20560207

MIM	HGNC	e!Ensembl
601534	6264	ENSG00000162989

Protein

UniProt ID

P48549

Protein name

G protein-activated inward rectifier potassium channel 1 (GIRK-1) (Inward rectifier K(+) channel Kir3.1) (Potassium channel, inwardly rectifying subfamily J member 3)

Protein function

Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potass

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01007	IRK	47 → 187	Inward rectifier potassium channel transmembrane domain	Domain
PF17655	IRK_C	194 → 365	Inward rectifier potassium channel C-terminal domain	Domain

Sequence

MSALRRKFGDDYQVVTTSSSGSGLQPQGPGQDPQQQLVPKKKRQRFVDKNGRCNVQHGNL
GSETSRYLSDLFTTLVDLKWRWNLFIFILTYTVAWLFMASMWWVIAYTRGDLNKAHVGNY
TPCVANVYNFPSAFLFFIETEATIGYGYRYITDKCPEGIILFLFQSILGSIVDAFLIGCM
FIKMSQPKKRAETLMFSEHAVISMRDGKLTLMFRVGNLRNSHMVSAQIRCKLLKSRQTPE
GEFLPLDQLELDVGFSTGADQLFLVSPLTICHVIDAKSPFYDLSQRSMQTEQFEIVVILE
GIVETTGMTCQARTSYTEDEVLWGHRFFPVISLEEGFFKVDYSQFHATFEVPTPPYSVKE
QEEMLLMSSPLIAPAITNSKERHNSVECLDGLDDITTKLPSKLQKITGREDFPKKLLRMS
STTSEKAYSLGDLPMKLQRISSVPGNSEEKLVSKTTKMLSDPMSQSVADLPPKLQKMAGG
AARMEGNLPAKLRKMNSDRFT

Sequence length

501

Interactions

View interactions

	KEGG		Reactome
	Circadian entrainment Retrograde endocannabinoid signaling Glutamatergic synapse Cholinergic synapse Serotonergic synapse Dopaminergic synapse Estrogen signaling pathway Oxytocin signaling pathway GnRH secretion Morphine addiction		Activation of G protein gated Potassium channels Inhibition of voltage gated Ca2+ channels via Gbeta/gamma subunits

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Schizophrenia	Schizophrenia	rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346 View all (12 more)	21927946

Show/Hide Text Mining Associations (18)

Disease Name	Relationship Type	References
Associations from Text Mining
Autism Spectrum Disorder	Associate	36068227
Bipolar Disorder	Inhibit	21927946
Breast Neoplasms	Associate	15603589, 27519272, 27698251, 27835900, 28252570, 31848385
Carcinoma Non Small Cell Lung	Associate	15541182
Cell Transformation Neoplastic	Associate	31848385
Diabetes Mellitus	Inhibit	28804970
Glycogen Storage Disease Type IV	Associate	12034888
Heart Failure	Associate	34588502
Hyperaldosteronism	Associate	34957562
Lymphatic Metastasis	Associate	15541182, 31848385
Lymphatic Metastasis	Stimulate	27519272, 27698251
Lymphedema	Associate	28252570
Mastodynia	Associate	24392765
Mental Disorders	Associate	21927946
Neoplasms	Associate	15541182, 27519272, 31848385
Neoplasms	Stimulate	27835900
Schizophrenia	Associate	21927946
Schizophrenia	Inhibit	21927946

KCNJ3 (potassium inwardly rectifying channel subfamily J member 3)