Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
3757
Gene name Gene Name - the full gene name approved by the HGNC.
Potassium voltage-gated channel subfamily H member 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
KCNH2
Synonyms (NCBI Gene) Gene synonyms aliases
ERG-1, ERG1, H-ERG, HERG, HERG1, Kv11.1, LQT2, SQT1
Chromosome Chromosome number
7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
7q36.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a voltage-activated potassium channel belonging to the eag family. It shares sequence similarity with the Drosophila ether-a-go-go (eag) gene. Mutations in this gene can cause long QT syndrome type 2 (LQT2). Transcript variants encoding
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs1137617 A>C,G,T Pathogenic, benign, likely-benign Coding sequence variant, stop gained, synonymous variant
rs9333649 C>A,G,T Not-provided, pathogenic Coding sequence variant, missense variant
rs12720441 G>A,C Likely-pathogenic, not-provided, risk-factor Missense variant, coding sequence variant
rs28928904 A>C,G,T Pathogenic, not-provided Missense variant, coding sequence variant
rs28928905 C>G,T Pathogenic, not-provided Missense variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT004831 hsa-miR-133a-3p Luciferase reporter assay, qRT-PCR, Western blot 17344217
MIRT004831 hsa-miR-133a-3p Luciferase reporter assay, qRT-PCR, Western blot 17344217
MIRT004832 hsa-miR-133b Luciferase reporter assay, qRT-PCR, Western blot 17344217
MIRT016707 hsa-miR-335-5p Microarray 18185580
MIRT025630 hsa-miR-7-5p Microarray 19073608
Transcription factors
Transcription factor Regulation Reference
SP1 Unknown 17311278
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000976 Function Transcription cis-regulatory region binding IDA 31146003
GO:0003064 Process Regulation of heart rate by hormone TAS 11953308
GO:0005216 Function Monoatomic ion channel activity IEA
GO:0005242 Function Inward rectifier potassium channel activity IBA
GO:0005242 Function Inward rectifier potassium channel activity IDA 9765245, 18559421
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
152427 6251 ENSG00000055118
Protein
UniProt ID Q12809
Protein name Voltage-gated inwardly rectifying potassium channel KCNH2 (Eag homolog) (Ether-a-go-go-related gene potassium channel 1) (ERG-1) (Eag-related protein 1) (Ether-a-go-go-related protein 1) (H-ERG) (hERG-1) (hERG1) (Potassium voltage-gated channel subfamily
Protein function Pore-forming (alpha) subunit of voltage-gated inwardly rectifying potassium channel (PubMed:10219239, PubMed:10753933, PubMed:10790218, PubMed:10837251, PubMed:11997281, PubMed:12063277, PubMed:18559421, PubMed:22314138, PubMed:22359612, PubMed:
PDB 1BYW , 1UJL , 2L0W , 2L1M , 2L4R , 2LE7 , 2N7G , 4HP9 , 4HQA , 5VA1 , 5VA2 , 5VA3 , 6SYG , 8IO4 , 8IO5 , 8IOB , 8ZYN , 8ZYO , 8ZYP , 8ZYQ , 9CHP , 9CHQ , 9CHR , 9CHS
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13426 PAS_9 29 131 PAS domain Domain
PF00520 Ion_trans 407 671 Ion transport protein Family
PF00027 cNMP_binding 760 845 Cyclic nucleotide-binding domain Domain
Tissue specificity TISSUE SPECIFICITY: Highly expressed in heart and brain. Isoforms USO are frequently overexpressed in cancer cells. {ECO:0000269|PubMed:18559421}.
Sequence
MPVRRGHVAPQNTFLDTIIRKFEGQSRKFIIANARVENCAVIYCNDGFCELCGYSRAEVM
QRPCTCDFLHGPRTQRRAAAQIAQALLGAEERKVEIAFYRKDGSCFLCLVDVVPVKNEDG
AVIMFILNFEV
VMEKDMVGSPAHDTNHRGPPTSWLAPGRAKTFRLKLPALLALTARESSV
RSGGAGGAGAPGAVVVDVDLTPAAPSSESLALDEVTAMDNHVAGLGPAEERRALVGPGSP
PRSAPGQLPSPRAHSLNPDASGSSCSLARTRSRESCASVRRASSADDIEAMRAGVLPPPP
RHASTGAMHPLRSGLLNSTSDSDLVRYRTISKIPQITLNFVDLKGDPFLASPTSDREIIA
PKIKERTHNVTEKVTQVLSLGADVLPEYKLQAPRIHRWTILHYSPFKAVWDWLILLLVIY
TAVFTPYSAAFLLKETEEGPPATECGYACQPLAVVDLIVDIMFIVDILINFRTTYVNANE
EVVSHPGRIAVHYFKGWFLIDMVAAIPFDLLIFGSGSEELIGLLKTARLLRLVRVARKLD
RYSEYGAAVLFLLMCTFALIAHWLACIWYAIGNMEQPHMDSRIGWLHNLGDQIGKPYNSS
GLGGPSIKDKYVTALYFTFSSLTSVGFGNVSPNTNSEKIFSICVMLIGSLMYASIFGNVS
AIIQRLYSGTA
RYHTQMLRVREFIRFHQIPNPLRQRLEEYFQHAWSYTNGIDMNAVLKGF
PECLQADICLHLNRSLLQHCKPFRGATKGCLRALAMKFKTTHAPPGDTLVHAGDLLTALY
FISRGSIEILRGDVVVAILGKNDIFGEPLNLYARPGKSNGDVRALTYCDLHKIHRDDLLE
VLDMY
PEFSDHFWSSLEITFNLRDTNMIPGSPGSTELEGGFSRQRKRKLSFRRRTDKDTE
QPGEVSALGPGRAGAGPSSRGRPGGPWGESPSSGPSSPESSEDEGPGRSSSPLRLVPFSS
PRPPGEPPGGEPLMEDCEKSSDTCNPLSGAFSGVSNIFSFWGDSRGRQYQELPRCPAPTP
SLLNIPLSSPGRRPRGDVESRLDALQRQLNRLETRLSADMATVLQLLQRQMTLVPPAYSA
VTTPGPGPTSTSPLLPVSPLPTLTLDSLSQVSQFMACEELPPGAPELPQEGPTRRLSLPG
QLGALTSQPLHRHGSDPGS
Sequence length 1159
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Voltage gated Potassium channels
Phase 3 - rapid repolarisation
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
cardiac arrhythmia Cardiac arrhythmia rs794728497, rs121912504, rs199472990, rs794728465, rs794728428, rs794728382, rs748706373, rs1554424044, rs794728499, rs794728489, rs28928905, rs794728462, rs199473428, rs794728472, rs794728426
View all (23 more)
N/A
Congenital Long QT Syndrome congenital long qt syndrome rs199472845, rs199473002, rs121912516, rs199472971, rs199473495, rs199472884, rs199473420, rs121912511, rs41307295, rs199473491, rs773724817, rs199473005, rs199472945, rs199472953, rs199473490
View all (73 more)
N/A
Long QT Syndrome long qt syndrome 2, long qt syndrome, Long QT syndrome 1/2, digenic, long qt syndrome 1 rs794728467, rs1057517743, rs1801462423, rs794728427, rs761863251, rs1563160541, rs794728391, rs1554424062, rs1554426258, rs199473524, rs199472950, rs748706373, rs199472926, rs1554424044, rs199473428
View all (224 more)
N/A
Short QT Syndrome Short QT syndrome type 1, short qt syndrome rs199473490, rs199473428, rs121912507, rs199472947, rs104894021, rs199472837, rs199473524, rs199472851, rs121912504 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
arrhythmogenic right ventricular cardiomyopathy Arrhythmogenic right ventricular cardiomyopathy N/A N/A ClinVar
Atrial Fibrillation atrial fibrillation, Atrial fibrillation N/A N/A ClinVar, GWAS
Brugada Syndrome brugada syndrome 1, brugada syndrome N/A N/A ClinVar
Cardiomyopathy Primary dilated cardiomyopathy N/A N/A ClinVar
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Acidosis Inhibit 31882846
Andersen Syndrome Associate 26109178, 28336205, 32843460
Aortic Aneurysm Thoracic Associate 31573043
Arrhythmias Cardiac Associate 12771193, 16565572, 18059314, 18192214, 18362022, 18551196, 19032804, 19528813, 20547678, 20809527, 21135103, 21158687, 21573751, 21951015, 22124116
View all (27 more)
Astrocytoma Associate 16175187
Atrial Fibrillation Associate 18452873, 24460807, 32715669, 33990324, 35114584
Atrioventricular Block Associate 10841244, 14998624, 18848812
Autosomal Recessive Primary Microcephaly Associate 32048431
Breast Neoplasms Associate 25596745, 25945833, 31659098
Brugada Syndrome Associate 27707468, 29672598, 32048431, 36197721, 36303204