Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	375611
Gene name Gene Name - the full gene name approved by the HGNC.	Solute carrier family 26 member 5
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	SLC26A5
Synonyms (NCBI Gene) Gene synonyms aliases	DFNB61, PRES
Chromosome Chromosome number	7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	7q22.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the SLC26A/SulP transporter family. The protein functions as a molecular motor in motile outer hair cells (OHCs) of the cochlea, inducing changes in cell length that act to amplify sound levels. The transmembrane protein is a

Show/Hide all(2)

SNP ID	Visualize variation	Clinical significance	Consequence
rs431905517	T>G	Pathogenic	Non coding transcript variant, missense variant, coding sequence variant
rs431905518	C>T	Pathogenic	Stop gained, non coding transcript variant, coding sequence variant

Show/Hide all(3)

miRTarBase ID	miRNA	Experiments
MIRT2440441	hsa-miR-3545-3p	CLIP-seq
MIRT2440442	hsa-miR-4293	CLIP-seq
MIRT2440443	hsa-miR-4539	CLIP-seq

Show/Hide all(48)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002931	Process	Response to ischemia	IEA
GO:0005515	Function	Protein binding	IPI	32296183, 39482536
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0006821	Process	Chloride transport	IEA
GO:0006821	Process	Chloride transport	ISS
GO:0007605	Process	Sensory perception of sound	IBA
GO:0007605	Process	Sensory perception of sound	IEA
GO:0007605	Process	Sensory perception of sound	IMP	12719379
GO:0008271	Function	Secondary active sulfate transmembrane transporter activity	IEA
GO:0008360	Process	Regulation of cell shape	IEA
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0009751	Process	Response to salicylic acid	IEA
GO:0010996	Process	Response to auditory stimulus	IEA
GO:0015116	Function	Sulfate transmembrane transporter activity	IBA
GO:0015701	Process	Bicarbonate transport	IEA
GO:0015701	Process	Bicarbonate transport	ISS
GO:0015755	Process	Fructose transmembrane transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0016323	Component	Basolateral plasma membrane	IEA
GO:0016323	Component	Basolateral plasma membrane	ISS
GO:0016328	Component	Lateral plasma membrane	IDA	12584604, 14553901
GO:0016328	Component	Lateral plasma membrane	IEA
GO:0019531	Function	Oxalate transmembrane transporter activity	IBA
GO:0019532	Process	Oxalate transport	IBA
GO:0019532	Process	Oxalate transport	IEA
GO:0030507	Function	Spectrin binding	IEA
GO:0034220	Process	Monoatomic ion transmembrane transport	IEA
GO:0034766	Process	Negative regulation of monoatomic ion transmembrane transport	IEA
GO:0035864	Process	Response to potassium ion	IEA
GO:0042391	Process	Regulation of membrane potential	IEA
GO:0042802	Function	Identical protein binding	IEA
GO:0042803	Function	Protein homodimerization activity	IDA	34390643
GO:0045793	Process	Positive regulation of cell size	IEA
GO:0055085	Process	Transmembrane transport	IEA
GO:0090102	Process	Cochlea development	IEA
GO:0097066	Process	Response to thyroid hormone	IEA
GO:0098656	Process	Monoatomic anion transmembrane transport	IEA
GO:0120249	Component	Lateral wall of outer hair cell	IEA
GO:0140900	Function	Chloride:bicarbonate antiporter activity	IBA
GO:0140900	Function	Chloride:bicarbonate antiporter activity	IEA
GO:0140900	Function	Chloride:bicarbonate antiporter activity	ISS
GO:1902074	Process	Response to salt	IEA
GO:1902358	Process	Sulfate transmembrane transport	IBA
GO:1902358	Process	Sulfate transmembrane transport	IEA
GO:1902476	Process	Chloride transmembrane transport	IBA
GO:1902476	Process	Chloride transmembrane transport	IEA
GO:2000147	Process	Positive regulation of cell motility	IEA

MIM	HGNC	e!Ensembl
604943	9359	ENSG00000170615

Protein

UniProt ID

P58743

Protein name

Prestin (Solute carrier family 26 member 5)

Protein function

Voltage-sensitive motor protein that drives outer hair cell (OHC) electromotility (eM) and participates in sound amplification in the hearing organ (By similarity). Converts changes in the transmembrane electric potential into mechanical displac

PDB

7LGU , 7LGW , 7LH2 , 7LH3

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00916	Sulfate_transp	80 → 475	Sulfate permease family	Family
PF01740	STAS	526 → 709	STAS domain	Domain

Sequence

MDHAEENEILAATQRYYVERPIFSHPVLQERLHTKDKVPDSIADKLKQAFTCTPKKIRNI
IYMFLPITKWLPAYKFKEYVLGDLVSGISTGVLQLPQGLAFAMLAAVPPIFGLYSSFYPV
IMYCFLGTSRHISIGPFAVISLMIGGVAVRLVPDDIVIPGGVNATNGTEARDALRVKVAM
SVTLLSGIIQFCLGVCRFGFVAIYLTEPLVRGFTTAAAVHVFTSMLKYLFGVKTKRYSGI
FSVVYSTVAVLQNVKNLNVCSLGVGLMVFGLLLGGKEFNERFKEKLPAPIPLEFFAVVMG
TGISAGFNLKESYNVDVVGTLPLGLLPPANPDTSLFHLVYVDAIAIAIVGFSVTISMAKT
LANKHGYQVDGNQELIALGLCNSIGSLFQTFSISCSLSRSLVQEGTGGKTQLAGCLASLM
ILLVILATGFLFESLPQAVLSAIVIVNLKGMFMQFSDLPFFWRTSKIELTIWLTTFVSSL
FLGLDYGLITAVIIALLTVIYRTQSPSYKVLGKLPETDVYIDIDAYEEVKEIPGIKIFQI
NAPIYYANSDLYSNALKRKTGVNPAVIMGARRKAMRKYAKEVGNANMANATVVKADAEVD
GEDATKPEEEDGEVKYPPIVIKSTFPEEMQRFMPPGDNVHTVILDFTQVNFIDSVGVKTL
AGIVKEYGDVGIYVYLAGCSAQVVNDLTRNRFFENPALWELLFHSIHDAVLGSQLREALA
EQEASAPPSQEDLEPNATPATPEA

Sequence length

744

Interactions

View interactions

Show/Hide Causal Diseases (1)

Disease merge term	Disease name	dbSNP ID	References
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Deafness	Autosomal recessive nonsyndromic hearing loss 61	rs431905517, rs431905518	N/A

Show/Hide Unknown Diseases (3)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
hearing impairment	Hearing impairment	N/A	N/A	ClinVar
Hearing Loss	Hearing loss, autosomal recessive	N/A	N/A	ClinVar
Restless Legs Syndrome	Restless legs syndrome	N/A	N/A	GWAS

Show/Hide Text Mining Associations (4)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Hearing Loss	Associate	20668687, 24164807, 27041369, 35064195
Hearing Loss Sensorineural	Associate	20146813
Neoplastic Syndromes Hereditary	Associate	20668687
Wounds and Injuries	Inhibit	35064195

SLC26A5 (solute carrier family 26 member 5)