KCNG1 (potassium voltage-gated channel modifier subfamily G member 1)

Gene

• Entrez ID: 3755
• Gene name: Potassium voltage-gated channel modifier subfamily G member 1
• Gene symbol: KCNG1
• Synonyms (NCBI Gene): K13, KCNG, KV6.1, kH2
• Chromosome: 20
• Chromosome location: 20q13.13
• Summary: Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuro

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT043216	hsa-miR-324-5p	CLASH	23622248
MIRT1080947	hsa-miR-1234	CLIP-seq
MIRT1080948	hsa-miR-1285	CLIP-seq
MIRT1080949	hsa-miR-1288	CLIP-seq
MIRT1080950	hsa-miR-129-5p	CLIP-seq
MIRT1080951	hsa-miR-1587	CLIP-seq
MIRT1080952	hsa-miR-1908	CLIP-seq
MIRT1080953	hsa-miR-3169	CLIP-seq
MIRT1080954	hsa-miR-3187-5p	CLIP-seq
MIRT1080955	hsa-miR-3667-3p	CLIP-seq
MIRT1080956	hsa-miR-378g	CLIP-seq
MIRT1080957	hsa-miR-3945	CLIP-seq
MIRT1080958	hsa-miR-4253	CLIP-seq
MIRT1080959	hsa-miR-4492	CLIP-seq
MIRT1080960	hsa-miR-4498	CLIP-seq
MIRT1080961	hsa-miR-4502	CLIP-seq
MIRT1080962	hsa-miR-4505	CLIP-seq
MIRT1080963	hsa-miR-4508	CLIP-seq
MIRT1080964	hsa-miR-4648	CLIP-seq
MIRT1080965	hsa-miR-4654	CLIP-seq
MIRT1080966	hsa-miR-4656	CLIP-seq
MIRT1080967	hsa-miR-4675	CLIP-seq
MIRT1080968	hsa-miR-4707-5p	CLIP-seq
MIRT1080969	hsa-miR-4731-5p	CLIP-seq
MIRT1080970	hsa-miR-4741	CLIP-seq
MIRT1080971	hsa-miR-4769-5p	CLIP-seq
MIRT1080972	hsa-miR-4793-3p	CLIP-seq
MIRT1080973	hsa-miR-612	CLIP-seq
MIRT1080974	hsa-miR-663	CLIP-seq
MIRT1080975	hsa-miR-744	CLIP-seq
MIRT1080976	hsa-miR-762	CLIP-seq
MIRT2020067	hsa-miR-1207-5p	CLIP-seq
MIRT2020068	hsa-miR-4514	CLIP-seq
MIRT2020069	hsa-miR-4692	CLIP-seq
MIRT2020070	hsa-miR-4763-3p	CLIP-seq
MIRT2020067	hsa-miR-1207-5p	CLIP-seq
MIRT2020070	hsa-miR-4763-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001508	Process	Action potential	IBA
GO:0005216	Function	Monoatomic ion channel activity	IEA
GO:0005249	Function	Voltage-gated potassium channel activity	IEA
GO:0005267	Function	Potassium channel activity	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006813	Process	Potassium ion transport	IEA
GO:0006813	Process	Potassium ion transport	NAS	9434767
GO:0008076	Component	Voltage-gated potassium channel complex	IBA
GO:0008076	Component	Voltage-gated potassium channel complex	IDA	19074135
GO:0008076	Component	Voltage-gated potassium channel complex	IEA
GO:0008076	Component	Voltage-gated potassium channel complex	ISS
GO:0015459	Function	Potassium channel regulator activity	IBA
GO:0015459	Function	Potassium channel regulator activity	IDA	19074135
GO:0015459	Function	Potassium channel regulator activity	IEA
GO:0016020	Component	Membrane	IBA
GO:0016020	Component	Membrane	IEA
GO:0034220	Process	Monoatomic ion transmembrane transport	IEA
GO:0034702	Component	Monoatomic ion channel complex	IEA
GO:0043266	Process	Regulation of potassium ion transport	IEA
GO:0051260	Process	Protein homooligomerization	IEA
GO:0055085	Process	Transmembrane transport	IEA
GO:0071805	Process	Potassium ion transmembrane transport	IBA
GO:0071805	Process	Potassium ion transmembrane transport	IEA
GO:1901379	Process	Regulation of potassium ion transmembrane transport	IEA
GO:1901379	Process	Regulation of potassium ion transmembrane transport	ISS

Other IDs

• MIM: 603788
• HGNC: 6248
• e!Ensembl: ENSG00000026559

Protein

• UniProt ID: Q9UIX4
• Protein name: Voltage-gated potassium channel regulatory subunit KCNG1 (Potassium voltage-gated channel subfamily G member 1) (Voltage-gated potassium channel subunit Kv6.1) (kH2)
• Protein function: Regulatory alpha-subunit of the voltage-gated potassium (Kv) channel which, when coassembled with KCNB1 or KCNB2, can modulate their expression and their gating kinetics by acting on deactivation upon repolarization and inactivation during maint
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02214	BTB_2	65 → 164	BTB/POZ domain	Domain
  PF00520	Ion_trans	226 → 471	Ion transport protein	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in brain and placenta, and at much lower levels in kidney and pancreas (PubMed:9434767). {ECO:0000269|PubMed:9434767}.
• Sequence:

  MTLLPGDNSDYDYSALSCTSDASFHPAFLPQRQAIKGAFYRRAQRLRPQDEPRQGCQPED
  RRRRIIINVGGIKYSLPWTTLDEFPLTRLGQLKACTNFDDILNVCDDYDVTCNEFFFDRN
  PGAFGTILTFLRAGKLRLLREMCALSFQEELLYWGIAEDHLDGCCKRRYLQKIEEFAEMV
  EREEEDDALDSEGRDSEGPAEGEGRLGRCMRRLRDMVERPHSGLPGKVFACLSVLFVTVT
  AVNLSVSTLPSLREEEEQGHCSQMCHNVFIVESVCVGWFSLEFLLRLIQAPSKFAFLRSP
  LTLIDLVAILPYYITLLVDGAAAGRRKPGAGNSYLDKVGLVLRVLRALRILYVMRLARHS
  LGLQTLGLTARRCTREFGLLLLFLCVAIALFAPLLYVIENEMADSPEFTSIPACYWWAVI
  TMTTVGYGDMVPRSTPGQVVALSSILSGILLMAFPVTSIFHTFSRSYLELKQEQERVMFR
  RAQFLIKTKSQLSVSQDSDILFGSASSDTRDNN

• Sequence length: 513

Pathways

Reactome:

Voltage gated Potassium channels