Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	3755
Gene name Gene Name - the full gene name approved by the HGNC.	Potassium voltage-gated channel modifier subfamily G member 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	KCNG1
Synonyms (NCBI Gene) Gene synonyms aliases	K13, KCNG, KV6.1, kH2
Chromosome Chromosome number	20
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	20q13.13
Summary Summary of gene provided in NCBI Entrez Gene.	Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuro

Show/Hide all(37)

miRTarBase ID	miRNA	Experiments	Reference
MIRT043216	hsa-miR-324-5p	CLASH	23622248
MIRT1080947	hsa-miR-1234	CLIP-seq
MIRT1080948	hsa-miR-1285	CLIP-seq
MIRT1080949	hsa-miR-1288	CLIP-seq
MIRT1080950	hsa-miR-129-5p	CLIP-seq
MIRT1080951	hsa-miR-1587	CLIP-seq
MIRT1080952	hsa-miR-1908	CLIP-seq
MIRT1080953	hsa-miR-3169	CLIP-seq
MIRT1080954	hsa-miR-3187-5p	CLIP-seq
MIRT1080955	hsa-miR-3667-3p	CLIP-seq
MIRT1080956	hsa-miR-378g	CLIP-seq
MIRT1080957	hsa-miR-3945	CLIP-seq
MIRT1080958	hsa-miR-4253	CLIP-seq
MIRT1080959	hsa-miR-4492	CLIP-seq
MIRT1080960	hsa-miR-4498	CLIP-seq
MIRT1080961	hsa-miR-4502	CLIP-seq
MIRT1080962	hsa-miR-4505	CLIP-seq
MIRT1080963	hsa-miR-4508	CLIP-seq
MIRT1080964	hsa-miR-4648	CLIP-seq
MIRT1080965	hsa-miR-4654	CLIP-seq
MIRT1080966	hsa-miR-4656	CLIP-seq
MIRT1080967	hsa-miR-4675	CLIP-seq
MIRT1080968	hsa-miR-4707-5p	CLIP-seq
MIRT1080969	hsa-miR-4731-5p	CLIP-seq
MIRT1080970	hsa-miR-4741	CLIP-seq
MIRT1080971	hsa-miR-4769-5p	CLIP-seq
MIRT1080972	hsa-miR-4793-3p	CLIP-seq
MIRT1080973	hsa-miR-612	CLIP-seq
MIRT1080974	hsa-miR-663	CLIP-seq
MIRT1080975	hsa-miR-744	CLIP-seq
MIRT1080976	hsa-miR-762	CLIP-seq
MIRT2020067	hsa-miR-1207-5p	CLIP-seq
MIRT2020068	hsa-miR-4514	CLIP-seq
MIRT2020069	hsa-miR-4692	CLIP-seq
MIRT2020070	hsa-miR-4763-3p	CLIP-seq
MIRT2020067	hsa-miR-1207-5p	CLIP-seq
MIRT2020070	hsa-miR-4763-3p	CLIP-seq

Show/Hide all(27)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001508	Process	Action potential	IBA
GO:0005216	Function	Monoatomic ion channel activity	IEA
GO:0005249	Function	Voltage-gated potassium channel activity	IEA
GO:0005267	Function	Potassium channel activity	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006813	Process	Potassium ion transport	IEA
GO:0006813	Process	Potassium ion transport	NAS	9434767
GO:0008076	Component	Voltage-gated potassium channel complex	IBA
GO:0008076	Component	Voltage-gated potassium channel complex	IDA	19074135
GO:0008076	Component	Voltage-gated potassium channel complex	IEA
GO:0008076	Component	Voltage-gated potassium channel complex	ISS
GO:0015459	Function	Potassium channel regulator activity	IBA
GO:0015459	Function	Potassium channel regulator activity	IDA	19074135
GO:0015459	Function	Potassium channel regulator activity	IEA
GO:0016020	Component	Membrane	IBA
GO:0016020	Component	Membrane	IEA
GO:0034220	Process	Monoatomic ion transmembrane transport	IEA
GO:0034702	Component	Monoatomic ion channel complex	IEA
GO:0043266	Process	Regulation of potassium ion transport	IEA
GO:0051260	Process	Protein homooligomerization	IEA
GO:0055085	Process	Transmembrane transport	IEA
GO:0071805	Process	Potassium ion transmembrane transport	IBA
GO:0071805	Process	Potassium ion transmembrane transport	IEA
GO:1901379	Process	Regulation of potassium ion transmembrane transport	IEA
GO:1901379	Process	Regulation of potassium ion transmembrane transport	ISS

MIM	HGNC	e!Ensembl
603788	6248	ENSG00000026559

Protein

UniProt ID

Q9UIX4

Protein name

Voltage-gated potassium channel regulatory subunit KCNG1 (Potassium voltage-gated channel subfamily G member 1) (Voltage-gated potassium channel subunit Kv6.1) (kH2)

Protein function

Regulatory alpha-subunit of the voltage-gated potassium (Kv) channel which, when coassembled with KCNB1 or KCNB2, can modulate their expression and their gating kinetics by acting on deactivation upon repolarization and inactivation during maint

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02214	BTB_2	65 → 164	BTB/POZ domain	Domain
PF00520	Ion_trans	226 → 471	Ion transport protein	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in brain and placenta, and at much lower levels in kidney and pancreas (PubMed:9434767). {ECO:0000269|PubMed:9434767}.

Sequence

MTLLPGDNSDYDYSALSCTSDASFHPAFLPQRQAIKGAFYRRAQRLRPQDEPRQGCQPED
RRRRIIINVGGIKYSLPWTTLDEFPLTRLGQLKACTNFDDILNVCDDYDVTCNEFFFDRN
PGAFGTILTFLRAGKLRLLREMCALSFQEELLYWGIAEDHLDGCCKRRYLQKIEEFAEMV
EREEEDDALDSEGRDSEGPAEGEGRLGRCMRRLRDMVERPHSGLPGKVFACLSVLFVTVT
AVNLSVSTLPSLREEEEQGHCSQMCHNVFIVESVCVGWFSLEFLLRLIQAPSKFAFLRSP
LTLIDLVAILPYYITLLVDGAAAGRRKPGAGNSYLDKVGLVLRVLRALRILYVMRLARHS
LGLQTLGLTARRCTREFGLLLLFLCVAIALFAPLLYVIENEMADSPEFTSIPACYWWAVI
TMTTVGYGDMVPRSTPGQVVALSSILSGILLMAFPVTSIFHTFSRSYLELKQEQERVMFR
RAQFLIKTKSQLSVSQDSDILFGSASSDTRDNN

Sequence length

513

Interactions

View interactions

	Reactome
			Voltage gated Potassium channels

Show/Hide Unknown Diseases (3)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Bipolar Disorder	Bipolar disorder, Bipolar I disorder	N/A	N/A	GWAS
Diabetes	Bipolar disorder or type 2 diabetes	N/A	N/A	GWAS
Schizophrenia	Schizophrenia	N/A	N/A	GWAS

Show/Hide Text Mining Associations (3)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Adenocarcinoma of Lung	Associate	35441736
Laryngeal Neoplasms	Associate	37875354
Triple Negative Breast Neoplasms	Stimulate	37311278

KCNG1 (potassium voltage-gated channel modifier subfamily G member 1)