KCNG1 (potassium voltage-gated channel modifier subfamily G member 1)

Gene

• Entrez ID: 3755
• Gene name: Potassium voltage-gated channel modifier subfamily G member 1
• Gene symbol: KCNG1
• Synonyms (NCBI Gene): K13, KCNG, KV6.1, kH2
• Chromosome: 20
• Chromosome location: 20q13.13
• Summary: Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuro

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT043216	hsa-miR-324-5p	CLASH	23622248
MIRT1080947	hsa-miR-1234	CLIP-seq
MIRT1080948	hsa-miR-1285	CLIP-seq
MIRT1080949	hsa-miR-1288	CLIP-seq
MIRT1080950	hsa-miR-129-5p	CLIP-seq
MIRT1080951	hsa-miR-1587	CLIP-seq
MIRT1080952	hsa-miR-1908	CLIP-seq
MIRT1080953	hsa-miR-3169	CLIP-seq
MIRT1080954	hsa-miR-3187-5p	CLIP-seq
MIRT1080955	hsa-miR-3667-3p	CLIP-seq
MIRT1080956	hsa-miR-378g	CLIP-seq
MIRT1080957	hsa-miR-3945	CLIP-seq
MIRT1080958	hsa-miR-4253	CLIP-seq
MIRT1080959	hsa-miR-4492	CLIP-seq
MIRT1080960	hsa-miR-4498	CLIP-seq
MIRT1080961	hsa-miR-4502	CLIP-seq
MIRT1080962	hsa-miR-4505	CLIP-seq
MIRT1080963	hsa-miR-4508	CLIP-seq
MIRT1080964	hsa-miR-4648	CLIP-seq
MIRT1080965	hsa-miR-4654	CLIP-seq
MIRT1080966	hsa-miR-4656	CLIP-seq
MIRT1080967	hsa-miR-4675	CLIP-seq
MIRT1080968	hsa-miR-4707-5p	CLIP-seq
MIRT1080969	hsa-miR-4731-5p	CLIP-seq
MIRT1080970	hsa-miR-4741	CLIP-seq
MIRT1080971	hsa-miR-4769-5p	CLIP-seq
MIRT1080972	hsa-miR-4793-3p	CLIP-seq
MIRT1080973	hsa-miR-612	CLIP-seq
MIRT1080974	hsa-miR-663	CLIP-seq
MIRT1080975	hsa-miR-744	CLIP-seq
MIRT1080976	hsa-miR-762	CLIP-seq
MIRT2020067	hsa-miR-1207-5p	CLIP-seq
MIRT2020068	hsa-miR-4514	CLIP-seq
MIRT2020069	hsa-miR-4692	CLIP-seq
MIRT2020070	hsa-miR-4763-3p	CLIP-seq
MIRT2020067	hsa-miR-1207-5p	CLIP-seq
MIRT2020070	hsa-miR-4763-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005249	Function	Voltage-gated potassium channel activity	IBA	21873635
GO:0005251	Function	Delayed rectifier potassium channel activity	IBA	21873635
GO:0005251	Function	Delayed rectifier potassium channel activity	IDA	19074135
GO:0005251	Function	Delayed rectifier potassium channel activity	ISS
GO:0005267	Function	Potassium channel activity	NAS	9434767
GO:0005886	Component	Plasma membrane	IDA	19074135
GO:0005886	Component	Plasma membrane	ISS
GO:0005886	Component	Plasma membrane	TAS
GO:0006813	Process	Potassium ion transport	NAS	9434767
GO:0008076	Component	Voltage-gated potassium channel complex	IDA	19074135
GO:0008076	Component	Voltage-gated potassium channel complex	ISS
GO:0016021	Component	Integral component of membrane	IBA	21873635
GO:0051260	Process	Protein homooligomerization	IEA
GO:0071805	Process	Potassium ion transmembrane transport	IBA	21873635
GO:0071805	Process	Potassium ion transmembrane transport	IDA	19074135
GO:0071805	Process	Potassium ion transmembrane transport	ISS
GO:1902259	Process	Regulation of delayed rectifier potassium channel activity	IBA	21873635
GO:1902259	Process	Regulation of delayed rectifier potassium channel activity	ISS

Other IDs

• MIM: 603788
• HGNC: 6248
• e!Ensembl: ENSG00000026559

Protein

• UniProt ID: Q9UIX4
• Protein name: Voltage-gated potassium channel regulatory subunit KCNG1 (Potassium voltage-gated channel subfamily G member 1) (Voltage-gated potassium channel subunit Kv6.1) (kH2)
• Protein function: Regulatory alpha-subunit of the voltage-gated potassium (Kv) channel which, when coassembled with KCNB1 or KCNB2, can modulate their expression and their gating kinetics by acting on deactivation upon repolarization and inactivation during maint
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02214	BTB_2	65 → 164	BTB/POZ domain	Domain
  PF00520	Ion_trans	226 → 471	Ion transport protein	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in brain and placenta, and at much lower levels in kidney and pancreas (PubMed:9434767). {ECO:0000269|PubMed:9434767}.
• Sequence:

  MTLLPGDNSDYDYSALSCTSDASFHPAFLPQRQAIKGAFYRRAQRLRPQDEPRQGCQPED
  RRRRIIINVGGIKYSLPWTTLDEFPLTRLGQLKACTNFDDILNVCDDYDVTCNEFFFDRN
  PGAFGTILTFLRAGKLRLLREMCALSFQEELLYWGIAEDHLDGCCKRRYLQKIEEFAEMV
  EREEEDDALDSEGRDSEGPAEGEGRLGRCMRRLRDMVERPHSGLPGKVFACLSVLFVTVT
  AVNLSVSTLPSLREEEEQGHCSQMCHNVFIVESVCVGWFSLEFLLRLIQAPSKFAFLRSP
  LTLIDLVAILPYYITLLVDGAAAGRRKPGAGNSYLDKVGLVLRVLRALRILYVMRLARHS
  LGLQTLGLTARRCTREFGLLLLFLCVAIALFAPLLYVIENEMADSPEFTSIPACYWWAVI
  TMTTVGYGDMVPRSTPGQVVALSSILSGILLMAFPVTSIFHTFSRSYLELKQEQERVMFR
  RAQFLIKTKSQLSVSQDSDILFGSASSDTRDNN

• Sequence length: 513

Pathways

Reactome:

Voltage gated Potassium channels

Associated diseases

Unknown
Disease term	Disease name	Evidence	References	Source
Diabetes	Diabetes			GWAS
Bipolar Disorder	Bipolar Disorder			GWAS
Schizophrenia	Schizophrenia			GWAS

Associations from Text Mining
Disease Name	Relationship Type	References
Adenocarcinoma of Lung	Associate	35441736
Laryngeal Neoplasms	Associate	37875354
Triple Negative Breast Neoplasms	Stimulate	37311278