Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	374900
Gene name Gene Name - the full gene name approved by the HGNC.	Zinc finger protein 568
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	ZNF568
Synonyms (NCBI Gene) Gene synonyms aliases	ZFP568
Chromosome Chromosome number	19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	19q13.12

Show/Hide all(107)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019088	hsa-miR-335-5p	Microarray	18185580
MIRT024069	hsa-miR-1-3p	Microarray	18668037
MIRT618090	hsa-miR-212-5p	HITS-CLIP	23824327
MIRT618089	hsa-miR-3189-3p	HITS-CLIP	23824327
MIRT625405	hsa-miR-4635	HITS-CLIP	23824327
MIRT618088	hsa-miR-4448	HITS-CLIP	23824327
MIRT618084	hsa-miR-3613-3p	HITS-CLIP	23824327
MIRT618083	hsa-miR-4668-5p	HITS-CLIP	23824327
MIRT618090	hsa-miR-212-5p	HITS-CLIP	23824327
MIRT618089	hsa-miR-3189-3p	HITS-CLIP	23824327
MIRT618088	hsa-miR-4448	HITS-CLIP	23824327
MIRT618087	hsa-miR-4757-5p	HITS-CLIP	23824327
MIRT618086	hsa-miR-6744-3p	HITS-CLIP	23824327
MIRT618085	hsa-miR-6878-3p	HITS-CLIP	23824327
MIRT618084	hsa-miR-3613-3p	HITS-CLIP	23824327
MIRT618083	hsa-miR-4668-5p	HITS-CLIP	23824327
MIRT618090	hsa-miR-212-5p	HITS-CLIP	23824327
MIRT618089	hsa-miR-3189-3p	HITS-CLIP	23824327
MIRT625405	hsa-miR-4635	HITS-CLIP	23824327
MIRT618088	hsa-miR-4448	HITS-CLIP	23824327
MIRT618084	hsa-miR-3613-3p	HITS-CLIP	23824327
MIRT618083	hsa-miR-4668-5p	HITS-CLIP	23824327
MIRT618090	hsa-miR-212-5p	HITS-CLIP	23824327
MIRT618089	hsa-miR-3189-3p	HITS-CLIP	23824327
MIRT618088	hsa-miR-4448	HITS-CLIP	23824327
MIRT618087	hsa-miR-4757-5p	HITS-CLIP	23824327
MIRT618086	hsa-miR-6744-3p	HITS-CLIP	23824327
MIRT618085	hsa-miR-6878-3p	HITS-CLIP	23824327
MIRT618084	hsa-miR-3613-3p	HITS-CLIP	23824327
MIRT618083	hsa-miR-4668-5p	HITS-CLIP	23824327
MIRT1530138	hsa-miR-1227	CLIP-seq
MIRT1530139	hsa-miR-150	CLIP-seq
MIRT1530140	hsa-miR-217	CLIP-seq
MIRT1530141	hsa-miR-3144-3p	CLIP-seq
MIRT1530142	hsa-miR-4252	CLIP-seq
MIRT1530143	hsa-miR-4438	CLIP-seq
MIRT1530144	hsa-miR-455-5p	CLIP-seq
MIRT1530145	hsa-miR-4795-5p	CLIP-seq
MIRT1530146	hsa-miR-4797-5p	CLIP-seq
MIRT1530147	hsa-miR-5095	CLIP-seq
MIRT1530148	hsa-miR-562	CLIP-seq
MIRT1530149	hsa-miR-875-5p	CLIP-seq
MIRT1530150	hsa-miR-129-5p	CLIP-seq
MIRT1530151	hsa-miR-2053	CLIP-seq
MIRT1530152	hsa-miR-24	CLIP-seq
MIRT1530153	hsa-miR-3146	CLIP-seq
MIRT1530154	hsa-miR-3187-3p	CLIP-seq
MIRT1530155	hsa-miR-3607-3p	CLIP-seq
MIRT1530156	hsa-miR-4284	CLIP-seq
MIRT1530157	hsa-miR-4435	CLIP-seq
MIRT1530158	hsa-miR-4477b	CLIP-seq
MIRT1530159	hsa-miR-4701-5p	CLIP-seq
MIRT1530160	hsa-miR-4775	CLIP-seq
MIRT1530161	hsa-miR-548s	CLIP-seq
MIRT1530162	hsa-miR-569	CLIP-seq
MIRT1530163	hsa-miR-588	CLIP-seq
MIRT1530164	hsa-miR-590-3p	CLIP-seq
MIRT1530165	hsa-miR-764	CLIP-seq
MIRT1530166	hsa-miR-181a	CLIP-seq
MIRT1530167	hsa-miR-181b	CLIP-seq
MIRT1530168	hsa-miR-181c	CLIP-seq
MIRT1530169	hsa-miR-181d	CLIP-seq
MIRT1530170	hsa-miR-4262	CLIP-seq
MIRT1530171	hsa-miR-584	CLIP-seq
MIRT1530172	hsa-miR-628-5p	CLIP-seq
MIRT1530173	hsa-miR-145	CLIP-seq
MIRT1530174	hsa-miR-3124-3p	CLIP-seq
MIRT1530175	hsa-miR-3924	CLIP-seq
MIRT1530176	hsa-miR-4729	CLIP-seq
MIRT1530177	hsa-miR-587	CLIP-seq
MIRT2160288	hsa-miR-1226	CLIP-seq
MIRT2160289	hsa-miR-1229	CLIP-seq
MIRT2160290	hsa-miR-4733-3p	CLIP-seq
MIRT1530171	hsa-miR-584	CLIP-seq
MIRT2379612	hsa-miR-4307	CLIP-seq
MIRT1530166	hsa-miR-181a	CLIP-seq
MIRT1530167	hsa-miR-181b	CLIP-seq
MIRT1530168	hsa-miR-181c	CLIP-seq
MIRT1530169	hsa-miR-181d	CLIP-seq
MIRT1530170	hsa-miR-4262	CLIP-seq
MIRT1530138	hsa-miR-1227	CLIP-seq
MIRT2671592	hsa-miR-1284	CLIP-seq
MIRT2671593	hsa-miR-139-3p	CLIP-seq
MIRT2671594	hsa-miR-149	CLIP-seq
MIRT1530140	hsa-miR-217	CLIP-seq
MIRT2671595	hsa-miR-3064-5p	CLIP-seq
MIRT2671596	hsa-miR-30a	CLIP-seq
MIRT2671597	hsa-miR-30b	CLIP-seq
MIRT2671598	hsa-miR-30c	CLIP-seq
MIRT2671599	hsa-miR-30d	CLIP-seq
MIRT2671600	hsa-miR-30e	CLIP-seq
MIRT2671601	hsa-miR-3122	CLIP-seq
MIRT2671602	hsa-miR-3126-3p	CLIP-seq
MIRT1530155	hsa-miR-3607-3p	CLIP-seq
MIRT2671603	hsa-miR-3689a-3p	CLIP-seq
MIRT2671604	hsa-miR-3689c	CLIP-seq
MIRT2671605	hsa-miR-371-5p	CLIP-seq
MIRT2671606	hsa-miR-371b-5p	CLIP-seq
MIRT2671607	hsa-miR-3913-5p	CLIP-seq
MIRT1530142	hsa-miR-4252	CLIP-seq
MIRT1530143	hsa-miR-4438	CLIP-seq
MIRT1530144	hsa-miR-455-5p	CLIP-seq
MIRT2671608	hsa-miR-4684-5p	CLIP-seq
MIRT2671609	hsa-miR-4728-5p	CLIP-seq
MIRT2671610	hsa-miR-4794	CLIP-seq
MIRT1530147	hsa-miR-5095	CLIP-seq
MIRT2671611	hsa-miR-548c-3p	CLIP-seq

Show/Hide all(16)

GO ID	Ontology	Definition	Evidence
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	ISS
GO:0000976	Function	Transcription cis-regulatory region binding	ISS
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0001701	Process	In utero embryonic development	ISS
GO:0003677	Function	DNA binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0008270	Function	Zinc ion binding	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	ISS
GO:0046872	Function	Metal ion binding	IEA
GO:0060669	Process	Embryonic placenta morphogenesis	ISS
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IEA

MIM	HGNC	e!Ensembl
617566	25392	ENSG00000198453

Protein

UniProt ID

Q3ZCX4

Protein name

Zinc finger protein 568

Protein function

Has transcriptional repression activity, partially through the recruitment of the corepressor TRIM28 but also has repression activity independently of this interaction. Essential during embryonic development, where it acts as a direct repressor

PDB

7W5Q , 8J8N

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01352	KRAB	47 → 88	KRAB box	Family
PF00096	zf-C2H2	222 → 244	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	250 → 272	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	278 → 300	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	306 → 328	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	334 → 356	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	362 → 384	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	390 → 412	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	418 → 440	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	446 → 468	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	474 → 496	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	502 → 524	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	530 → 552	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	558 → 580	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	586 → 608	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	614 → 636	Zinc finger, C2H2 type	Domain

Sequence

MTSQSSVISNSCVTMERLSHMMERKAWCSQESALSEEEEDTTRPLETVTFKDVAVDLTQE
EWEQMKPAQRNLYRDVMLENYSNLVTVGCQVTKPDVIFKLEQEEEPWVMEEEMFGRHCPE
VWEVDEQIKKQQETLVRKVTSISKKILIKEKVIECKKVAKIFPLSSDIVTSRQSFYDCDS
LDKGLEHNLDLLRYEKGCVREKQSNEFGKPFYHCASYVVTPFKCNQCGQDFSHKFDLIRH
ERIHAGEKPYECKECGKAFSRKENLITHQKIHTGEKPYKCNECGKAFIQMSNLIRHHRIH
TGEKPYACKDCWKAFSQKSNLIEHERIHTGEKPYECKECGKSFSQKQNLIEHEKIHTGEK
PYACNECGRAFSRMSSVTLHMRSHTGEKPYKCNKCGKAFSQCSVFIIHMRSHTGEKPYVC
SECGKAFSQSSSLTVHMRNHTAEKPYECKECGKAFSRKENLITHQKIHTGEKPYECSECG
KAFIQMSNLIRHQRIHTGEKPYACTVCGKAFSQKSNLTEHEKIHTGEKPYHCNQCGKAFS
QRQNLLEHEKIHTGEKPFKCNECGKAFSRISSLTLHVRSHTGEKPYECNKCGKAFSQCSL
LIIHMRSHTGEKPFECNECGKAFSQRASLSIHKRGHTGERHQVY

Sequence length

644

Interactions

View interactions

	Reactome
			Generic Transcription Pathway

Show/Hide Unknown Diseases (3)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Alzheimer disease	Alzheimer's disease or family history of Alzheimer's disease	N/A	N/A	GWAS
Crohn Disease	Crohn's disease	N/A	N/A	GWAS
Inflammatory Bowel Disease	Inflammatory bowel disease	N/A	N/A	GWAS

Show/Hide Text Mining Associations (4)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Carcinogenesis	Associate	28257124
Neoplasms	Associate	28257124
Polyps	Associate	28257124
Stomach Neoplasms	Associate	32034058

ZNF568 (zinc finger protein 568)