Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
374887
Gene name Gene Name - the full gene name approved by the HGNC.
YjeF N-terminal domain containing 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
YJEFN3
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
19p13.11
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0002040 Process Sprouting angiogenesis ISS
GO:0005515 Function Protein binding IPI 32296183
GO:0005739 Component Mitochondrion IBA
GO:0006869 Process Lipid transport IEA
GO:0008593 Process Regulation of Notch signaling pathway ISS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
618607 24785 ENSG00000250067
Protein
UniProt ID A6XGL0
Protein name YjeF N-terminal domain-containing protein 3 (YjeF_N3) (hYjeF_N3) (ApoA-I-binding protein 2)
Protein function May accelerate cholesterol efflux from endothelial cells to high-density lipoprotein (HDL) and thereby regulates angiogenesis. May orchestrate hematopoietic stem and progenitor cell emergence from the hemogenic endothelium, a type of specialized
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF03853 YjeF_N 89 259 YjeF-related protein N-terminus Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in theca cells in ovary and in Leydig cells in testis (at protein level). Also expressed in brain and mammary gland. {ECO:0000269|PubMed:17533573}.
Sequence
MSSAAGPDPSEAPEERHFLRALELQPPLADMGRAELSSNATTSLVQRRKQAWGRQSWLEQ
IWNAGPVCQSTAEAAALERELLEDYRFGRQQLVELCGHASAVAVTKAFPLPALSRKQRTV
LVVCGPEQNGAVGLVCARHLRVFEYEPTIFYPTRSLDLLHRDLTTQCEKMDIPFLSYLPT
EVQLINEAYGLVVDAVLGPGVEPGEVGGPCTRALATLKLLSIPLVSLDIPSGWDAETGSD
SEDGLRPDVLVSLAAPKRC
AGRFSGRHHFVAGRFVPDDVRRKFALRLPGYTGTDCVAAL
Sequence length 299
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Breast Cancer Breast cancer N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma Associate 34872584
Carcinoma Renal Cell Inhibit 29618705
Inflammation Inhibit 29618705
Neoplasms Associate 34872584