YJEFN3 (YjeF N-terminal domain containing 3)

Gene Gene information from NCBI Gene database.
Gene Gene ontology Other IDs Protein
Entrez ID 374887
Gene name YjeF N-terminal domain containing 3
Gene symbol YJEFN3
Synonyms (NCBI Gene)
-
Chromosome 19
Chromosome location 19p13.11
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
10
Gene Gene ontology Other IDs Protein
Show/Hide all (10)
GO ID Ontology Definition Evidence Reference
GO:0002040 Process Sprouting angiogenesis ISS
GO:0005515 Function Protein binding IPI 32296183
GO:0005739 Component Mitochondrion IBA
GO:0006869 Process Lipid transport IEA
GO:0008593 Process Regulation of Notch signaling pathway ISS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene Gene ontology Other IDs Protein
MIM HGNC e!Ensembl
618607 24785 ENSG00000250067
Protein Protein information from UniProt database.
Gene Gene ontology Other IDs Protein
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
A6XGL0
Protein name YjeF N-terminal domain-containing protein 3 (YjeF_N3) (hYjeF_N3) (ApoA-I-binding protein 2)
Protein function May accelerate cholesterol efflux from endothelial cells to high-density lipoprotein (HDL) and thereby regulates angiogenesis. May orchestrate hematopoietic stem and progenitor cell emergence from the hemogenic endothelium, a type of specialized
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF03853 YjeF_N 89 → 259 YjeF-related protein N-terminus Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in theca cells in ovary and in Leydig cells in testis (at protein level). Also expressed in brain and mammary gland. {ECO:0000269|PubMed:17533573}.
Sequence 
MSSAAGPDPSEAPEERHFLRALELQPPLADMGRAELSSNATTSLVQRRKQAWGRQSWLEQ
IWNAGPVCQSTAEAAALERELLEDYRFGRQQLVELCGHASAVAVTKAFPLPALSRKQRTV
LVVCGPEQNGAVGLVCARHLRVFEYEPTIFYPTRSLDLLHRDLTTQCEKMDIPFLSYLPT
EVQLINEAYGLVVDAVLGPGVEPGEVGGPCTRALATLKLLSIPLVSLDIPSGWDAETGSD
SEDGLRPDVLVSLAAPKRCAGRFSGRHHFVAGRFVPDDVRRKFALRLPGYTGTDCVAAL
Sequence length 299
Interactions View interactions