Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
3748
Gene name Gene Name - the full gene name approved by the HGNC.
Potassium voltage-gated channel subfamily C member 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
KCNC3
Synonyms (NCBI Gene) Gene synonyms aliases
KSHIIID, KV3.3, SCA13
Disease Acronyms (UniProt) Disease acronyms from UniProt database
SCA13
Chromosome Chromosome number
19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
19q13.33
Summary Summary of gene provided in NCBI Entrez Gene.
The Shaker gene family of Drosophila encodes components of voltage-gated potassium channels and is comprised of four subfamilies. Based on sequence similarity, this gene is similar to one of these subfamilies, namely the Shaw subfamily. The protein encode
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs104894699 C>T Pathogenic Intron variant, coding sequence variant, missense variant
rs104894700 G>C,T Pathogenic Intron variant, coding sequence variant, missense variant
rs747618525 CGGGGGTGG>-,CGGGGGTGGCGGGGGTGG Likely-pathogenic, likely-benign Inframe insertion, coding sequence variant, intron variant, inframe deletion
rs797044872 C>T Pathogenic Missense variant, intron variant, coding sequence variant
rs879253883 G>A Pathogenic Missense variant, intron variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT712473 hsa-miR-4793-5p HITS-CLIP 19536157
MIRT712472 hsa-miR-6892-3p HITS-CLIP 19536157
MIRT712471 hsa-miR-3183 HITS-CLIP 19536157
MIRT712470 hsa-miR-4723-3p HITS-CLIP 19536157
MIRT712469 hsa-miR-6769b-3p HITS-CLIP 19536157
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005249 Function Voltage-gated potassium channel activity IBA 21873635
GO:0005249 Function Voltage-gated potassium channel activity IMP 19953606, 21479265, 23734863, 25756792
GO:0005251 Function Delayed rectifier potassium channel activity IBA 21873635
GO:0005856 Component Cytoskeleton IEA
GO:0005886 Component Plasma membrane IDA 23734863, 25152487, 25756792
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
176264 6235 ENSG00000131398
Protein
UniProt ID Q14003
Protein name Voltage-gated potassium channel KCNC3 (KSHIIID) (Potassium voltage-gated channel subfamily C member 3) (Voltage-gated potassium channel subunit Kv3.3)
Protein function Voltage-gated potassium channel that plays an important role in the rapid repolarization of fast-firing brain neurons. The channel opens in response to the voltage difference across the membrane, forming a potassium-selective channel through whi
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF11404 Potassium_chann 1 23 Potassium voltage-gated channel Family
PF02214 BTB_2 90 184 BTB/POZ domain Domain
PF00520 Ion_trans 289 550 Ion transport protein Family
Sequence
MLSSVCVSSFRGRQGASKQQPAPPPQPPESPPPPPLPPQQQQPAQPGPAASPAGPPAPRG
PGDRRAEPCPGLPAAAMGRHGGGGGDSGKIVINVGGVRHETYRSTLRTLPGTRLAGLTEP
EAAARFDYDPGADEFFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELGFWGIDETD
VEAC
CWMTYRQHRDAEEALDSFEAPDPAGAANAANAAGAHDGGLDDEAGAGGGGLDGAGG
ELKRLCFQDAGGGAGGPPGGAGGAGGTWWRRWQPRVWALFEDPYSSRAARYVAFASLFFI
LISITTFCLETHEGFIHISNKTVTQASPIPGAPPENITNVEVETEPFLTYVEGVCVVWFT
FEFLMRITFCPDKVEFLKSSLNIIDCVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVR
ILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGADPDDIL
GSNHTYFKNIPIGFWWAVVTMTTLGYGDMYPKTWSGMLVGALCALAGVLTIAMPVPVIVN
NFGMYYSLAM
AKQKLPKKKNKHIPRPPQPGSPNYCKPDPPPPPPPHPHHGSGGISPPPPI
TPPSMGVTVAGAYPAGPHTHPGLLRGGAGGLGIMGLPPLPAPGEPCPLAQEEVIEINRAD
PRPNGDPAAAALAHEDCPAIDQPAMSPEDKSPITPGSRGRYSRDRACFLLTDYAPSPDGS
IRKATGAPPLPPQDWRKPGPPSFLPDLNANAAAWISP
Sequence length 757
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Spinocerebellar ataxia   Voltage gated Potassium channels
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Cerebellar ataxia Progressive cerebellar ataxia rs28936415, rs199476133, rs540331226, rs797046006, rs863224069, rs138358708, rs1057519429, rs750959420, rs1568440440, rs1597846084, rs759460806, rs761486324, rs1240335250, rs1596489887
Developmental delay Global developmental delay rs28941770, rs199469464, rs281865469, rs143747297, rs398123009, rs587777428, rs786205133, rs606231459, rs797044854, rs797045027, rs864309504, rs878853160, rs886039902, rs886042046, rs886041291
View all (32 more)
Mental retardation Mild Mental Retardation, Intellectual Disability rs5742905, rs267607136, rs267607137, rs2131714307, rs267607038, rs267607042, rs80338685, rs137853127, rs80338815, rs28940893, rs387906309, rs121908096, rs121908099, rs587784365, rs121918315
View all (1024 more)
Nystagmus Nystagmus rs137852207, rs137852208, rs1928435502, rs137852209, rs137852210, rs1929191668, rs137852211, rs137852212, rs2124209414, rs387906720, rs387906721, rs1602791884, rs786205896
Associations from Text Mining
Disease Name Relationship Type References
Ataxia Associate 24030952, 37365508, 39596509
Cerebellar Diseases Associate 23912307
Cerebral Palsy Ataxic Autosomal Recessive Associate 25981959
Cognition Disorders Associate 39596509
Developmental Disabilities Associate 24372385
Drug Resistant Epilepsy Associate 28388656
Epilepsy Associate 24372385, 37365508
Gait Disorders Neurologic Associate 25756792
Intellectual Disability Associate 25756792
Oculomotor Nerve Diseases Associate 39596509