TEX9 (testis expressed 9)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID 374618
Gene name Testis expressed 9
Gene symbol TEX9
Synonyms (NCBI Gene)
-
Chromosome 15
Chromosome location 15q21.3
miRNA miRNA information provided by mirtarbase database.
91
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all (91)
miRTarBase ID miRNA Experiments Reference
MIRT712706 hsa-miR-5197-5p HITS-CLIP 19536157
MIRT712705 hsa-miR-144-3p HITS-CLIP 19536157
MIRT712704 hsa-miR-183-5p HITS-CLIP 19536157
MIRT712703 hsa-miR-513b-5p HITS-CLIP 19536157
MIRT712702 hsa-miR-5096 HITS-CLIP 19536157
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
5
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all (5)
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 16189514, 23455924, 26871637, 32296183, 33961781
GO:0005737 Component Cytoplasm IEA
GO:0005856 Component Cytoskeleton IEA
GO:0034451 Component Centriolar satellite IDA 26638075
GO:0034451 Component Centriolar satellite IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
620935 29585 ENSG00000151575
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8N6V9
Protein name Testis-expressed protein 9
Family and domains
Sequence 
MAGRSLCLTRSSVPGTPFPPPVQQPSTPGPDLLALEEEYKRLNAELQAKTADVVQQAKEI
IRDRQEVRSRPVSTQMKSCDDEDDYSLRGLLPSEGIVHLHSETKPKTKNIDPVNKVQNKL
HSANKGRKTNSSVKLKYSDVQTADDVAIPEDFSDFSLAKTISKIEGQLEEEGLPEYIDDI
FSGVSNDIGTEAQIRFLKAKLHVMQEELDNVVCECNKKEDEIQNLKSQVKNFEEDFMRQQ
RTINMQQSQVEKYKTLFEEANKKYDGLQQQLSSVERELENKRRLQKQAASSQSATEVRLN
RALEEAEKYKLELSKLRQNNKDIANEEHKKIEVLKSENKKLEKQKGELMIGFKKQLKLID
VLKRQKMHIEAAKMLSFTEEEFMKALEWGNS
Sequence length 391
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
3
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (3)
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Colorectal cancer Uncertain significance rs201973612 RCV005927159
Sarcoma Uncertain significance rs201973612 RCV005927160
Thyroid cancer, nonmedullary, 1 Uncertain significance rs201973612 RCV005927161