Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID	374
Gene name	Amphiregulin
Gene symbol	AREG
Synonyms (NCBI Gene)	ARAREGBCRDGFSDGF
Chromosome	4
Chromosome location	4q13.3
Summary	The protein encoded by this gene is a member of the epidermal growth factor family. It is an autocrine growth factor as well as a mitogen for astrocytes, Schwann cells and fibroblasts. It is related to epidermal growth factor (EGF) and transforming growth

Show/Hide all (11)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018541	hsa-miR-335-5p	Microarray	18185580
MIRT437742	hsa-miR-34a-5p	MicroarrayqRT-PCR	22815788
MIRT437873	hsa-miR-200a-3p	ELISAImmunohistochemistryImmunoprecipitaionLuciferase reporter assayMicroarrayqRT-PCRWestern blot	24762440
MIRT437873	hsa-miR-200a-3p	ELISAImmunohistochemistryImmunoprecipitaionLuciferase reporter assayMicroarrayqRT-PCRWestern blot	24762440
MIRT2435438	hsa-miR-135a	CLIP-seq
MIRT2435439	hsa-miR-135b	CLIP-seq
MIRT2435440	hsa-miR-34a	CLIP-seq
MIRT2435441	hsa-miR-34c-5p	CLIP-seq
MIRT2435442	hsa-miR-449a	CLIP-seq
MIRT2435443	hsa-miR-449b	CLIP-seq
MIRT2435444	hsa-miR-4729	CLIP-seq

Show/Hide all (3)

Transcription factor	Regulation	Reference
BRCA1	Repression	20103632
NFIL3	Unknown	1620116
SP1	Unknown	14742435

Show/Hide all (51)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005125	Function	Cytokine activity	IEA
GO:0005154	Function	Epidermal growth factor receptor binding	IBA
GO:0005154	Function	Epidermal growth factor receptor binding	IEA
GO:0005515	Function	Protein binding	IPI	19740107, 30083275, 32296183
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	8702723
GO:0005615	Component	Extracellular space	IDA	12743035, 22184114
GO:0005615	Component	Extracellular space	IEA
GO:0005615	Component	Extracellular space	IEA
GO:0005615	Component	Extracellular space	TAS	3413110
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0007173	Process	Epidermal growth factor receptor signaling pathway	IBA
GO:0007173	Process	Epidermal growth factor receptor signaling pathway	IDA	12743035
GO:0007173	Process	Epidermal growth factor receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IDA	12743035
GO:0007267	Process	Cell-cell signaling	TAS	2466334
GO:0008083	Function	Growth factor activity	IBA
GO:0008083	Function	Growth factor activity	IEA
GO:0008083	Function	Growth factor activity	TAS	2466334
GO:0008284	Process	Positive regulation of cell population proliferation	IBA
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IMP	12743035
GO:0009986	Component	Cell surface	IDA	12743035
GO:0010838	Process	Positive regulation of keratinocyte proliferation	TAS	2466334
GO:0012507	Component	ER to Golgi transport vesicle membrane	TAS
GO:0014009	Process	Glial cell proliferation	IEA
GO:0016020	Component	Membrane	IEA
GO:0030297	Function	Transmembrane receptor protein tyrosine kinase activator activity	IDA	8702723
GO:0030297	Function	Transmembrane receptor protein tyrosine kinase activator activity	IEA
GO:0030669	Component	Clathrin-coated endocytic vesicle membrane	IEA
GO:0030669	Component	Clathrin-coated endocytic vesicle membrane	TAS
GO:0031175	Process	Neuron projection development	IEA
GO:0032355	Process	Response to estradiol	IEA
GO:0033116	Component	Endoplasmic reticulum-Golgi intermediate compartment membrane	TAS
GO:0038134	Process	ERBB2-EGFR signaling pathway	IDA	8702723
GO:0042327	Process	Positive regulation of phosphorylation	IEA
GO:0042542	Process	Response to hydrogen peroxide	IEA
GO:0043434	Process	Response to peptide hormone	IEA
GO:0045668	Process	Negative regulation of osteoblast differentiation	IEA
GO:0048018	Function	Receptor ligand activity	IDA	8702723
GO:0048018	Function	Receptor ligand activity	IEA
GO:0051384	Process	Response to glucocorticoid	IEA
GO:0051591	Process	Response to cAMP	IEA
GO:0060598	Process	Dichotomous subdivision of terminal units involved in mammary gland duct morphogenesis	IEA
GO:0060744	Process	Mammary gland branching involved in thelarche	IEA
GO:0060749	Process	Mammary gland alveolus development	IEA
GO:0060750	Process	Epithelial cell proliferation involved in mammary gland duct elongation	IEA

MIM	HGNC	e!Ensembl
104640	651	ENSG00000109321

P15514

Protein name

Amphiregulin (AR) (Colorectum cell-derived growth factor) (CRDGF)

Protein function

Ligand of the EGF receptor/EGFR. Autocrine growth factor as well as a mitogen for a broad range of target cells including astrocytes, Schwann cells and fibroblasts.

PDB

2RNL

Family and domains

Sequence

MRAPLLPPAPVVLSLLILGSGHYAAGLDLNDTYSGKREPFSGDHSADGFEVTSRSEMSSG
SEISPVSEMPSSSEPSSGADYDYSEEYDNEPQIPGYIVDDSVRVEQVVKPPQNKTESENT
SDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGER
CGEKSMKTHSMIDSSLSKIALAAIAAFMSAVILTAVAVITVQLRRQYVRKYEGEAEERKK
LRQENGNVHAIA

Sequence length

252

Interactions

View interactions

	KEGG		Reactome
	MAPK signaling pathway ErbB signaling pathway PI3K-Akt signaling pathway Hippo signaling pathway Colorectal cancer		PIP3 activates AKT signaling Signaling by EGFR GRB2 events in EGFR signaling GAB1 signalosome SHC1 events in EGFR signaling EGFR downregulation COPII-mediated vesicle transport EGFR interacts with phospholipase C-gamma Constitutive Signaling by Aberrant PI3K in Cancer Inhibition of Signaling by Overexpressed EGFR RAF/MAP kinase cascade Cargo concentration in the ER PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling Cargo recognition for clathrin-mediated endocytosis Clathrin-mediated endocytosis Extra-nuclear estrogen signaling Estrogen-dependent nuclear events downstream of ESR-membrane signaling

AREG (amphiregulin)