H1-9P (H1.9 linker histone, pseudogene)

Gene

• Entrez ID: 373861
• Gene name: H1.9 linker histone, pseudogene
• Gene symbol: H1-9P
• Synonyms (NCBI Gene): H1-9, H1.9, HILS1
• Chromosome: 17
• Chromosome location: 17q21.33
• Summary: This locus is the ortholog of a mouse protein-coding gene that displays characteristics of a linker histone and is expressed in nuclei of late maturing spermatids. The human locus is expressed; however, the open reading frame has been disrupted by a frame

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000786	Component	Nucleosome	IDA	12920187
GO:0000786	Component	Nucleosome	IEA
GO:0001673	Component	Male germ cell nucleus	IDA	12920187
GO:0003676	Function	Nucleic acid binding	IDA	12920187
GO:0003677	Function	DNA binding	IEA
GO:0003690	Function	Double-stranded DNA binding	IBA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005694	Component	Chromosome	IEA
GO:0006325	Process	Chromatin organization	IEA
GO:0006334	Process	Nucleosome assembly	IEA
GO:0006338	Process	Chromatin remodeling	NAS	12920187
GO:0006355	Process	Regulation of DNA-templated transcription	NAS	12920187
GO:0007281	Process	Germ cell development	IDA	14636221
GO:0007283	Process	Spermatogenesis	IDA	12920187
GO:0007283	Process	Spermatogenesis	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0030261	Process	Chromosome condensation	IBA
GO:0030261	Process	Chromosome condensation	IDA	12920187
GO:0030261	Process	Chromosome condensation	IEA
GO:0031492	Function	Nucleosomal DNA binding	IBA
GO:0031507	Process	Heterochromatin formation	IDA	12920187
GO:0042393	Function	Histone binding	IDA	12920187
GO:0045910	Process	Negative regulation of DNA recombination	IBA

Other IDs

• MIM: 608101
• HGNC: 30616
• e!Ensembl: ENSG00000253730

Protein

• UniProt ID: P60008
• Protein name: Putative histone H1.9 (H1.9 linker histone pseudogene) (Putative spermatid-specific linker histone H1-like protein)
• Protein function: DNA-binding protein that may be implicated in chromatin remodeling and/or transcriptional regulation during spermiogenesis, the process of spermatid maturation into spermatozoa.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00538	Linker_histone	114 → 187	linker histone H1 and H5 family	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed exclusively in the testis. {ECO:0000269|PubMed:12920187}.
• Sequence:

  MLHASTIWHLRSTPPRRKQWGHCDPHRILVASEVTTEITSPTPAPRAQVCGGQPWVTVLD
  PLSGHTGREAERHFATVSISAVELKYCHGWRPAGQRVPSKTATGQRTCAKPCQKPSTSKV
  ILRAVADKGTCKYVSLATLKKAVSTTGYDMARNAYHFKRVLKGLVDKGSAGSFTLGKKQA
  SKSKLKVKRQRQQRWRSGQRPFGQHRSLLGSKQGHKRLIKGVRRVAKCHCN

• Sequence length: 231