Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
373861
Gene name Gene Name - the full gene name approved by the HGNC.
H1.9 linker histone, pseudogene
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
H1-9P
Synonyms (NCBI Gene) Gene synonyms aliases
H1-9, H1.9, HILS1
Chromosome Chromosome number
17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
17q21.33
Summary Summary of gene provided in NCBI Entrez Gene.
This locus is the ortholog of a mouse protein-coding gene that displays characteristics of a linker histone and is expressed in nuclei of late maturing spermatids. The human locus is expressed; however, the open reading frame has been disrupted by a frame
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000786 Component Nucleosome IDA 12920187
GO:0001673 Component Male germ cell nucleus IDA 12920187
GO:0003676 Function Nucleic acid binding IDA 12920187
GO:0003690 Function Double-stranded DNA binding IBA 21873635
GO:0005634 Component Nucleus IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
608101 30616 ENSG00000253730
Protein
UniProt ID P60008
Protein name Putative histone H1.9 (H1.9 linker histone pseudogene) (Putative spermatid-specific linker histone H1-like protein)
Protein function DNA-binding protein that may be implicated in chromatin remodeling and/or transcriptional regulation during spermiogenesis, the process of spermatid maturation into spermatozoa.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00538 Linker_histone 114 187 linker histone H1 and H5 family Domain
Tissue specificity TISSUE SPECIFICITY: Expressed exclusively in the testis. {ECO:0000269|PubMed:12920187}.
Sequence
MLHASTIWHLRSTPPRRKQWGHCDPHRILVASEVTTEITSPTPAPRAQVCGGQPWVTVLD
PLSGHTGREAERHFATVSISAVELKYCHGWRPAGQRVPSKTATGQRTCAKPCQKPSTSKV
ILRAVADKGTCKYVSLATLKKAVSTTGYDMARNAYHFKRVLKGLVDKGSAGSFTLGKKQA
SKSKLKV
KRQRQQRWRSGQRPFGQHRSLLGSKQGHKRLIKGVRRVAKCHCN
Sequence length 231
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Limb-girdle muscular dystrophy Alpha-Sarcoglycanopathies rs2137534216, rs104894422, rs762777463, rs104894423, rs137854524, rs137854521, rs137854523, rs137854529, rs398123555, rs119463996, rs587777814, rs119463992, rs267606971, rs267606967, rs28941782
View all (762 more)