Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	3732
Gene name	CD82 molecule
Gene symbol	CD82
Synonyms (NCBI Gene)	4F9C33GR15IA4KAI1R2SAR2ST6TSPAN27
Chromosome	11
Chromosome location	11p11.2
Summary	This metastasis suppressor gene product is a membrane glycoprotein that is a member of the transmembrane 4 superfamily. Expression of this gene has been shown to be downregulated in tumor progression of human cancers and can be activated by p53 through a

188

Show/Hide all (188)

miRTarBase ID	miRNA	Experiments	Reference
MIRT054277	hsa-miR-362-3p	Luciferase reporter assayqRT-PCRWestern blot	25652145
MIRT054277	hsa-miR-362-3p	Luciferase reporter assayqRT-PCRWestern blot	25652145
MIRT054634	hsa-miR-197-3p	ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	24613834
MIRT054634	hsa-miR-197-3p	ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	24613834
MIRT650687	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT650686	hsa-miR-4294	HITS-CLIP	23824327
MIRT650685	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT650684	hsa-miR-6888-3p	HITS-CLIP	23824327
MIRT650683	hsa-miR-3672	HITS-CLIP	23824327
MIRT650682	hsa-miR-6864-3p	HITS-CLIP	23824327
MIRT650681	hsa-miR-4743-3p	HITS-CLIP	23824327
MIRT650680	hsa-miR-4652-3p	HITS-CLIP	23824327
MIRT650679	hsa-miR-8055	HITS-CLIP	23824327
MIRT650678	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT054634	hsa-miR-197-3p	ImmunofluorescenceImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	28252644
MIRT054634	hsa-miR-197-3p	ImmunofluorescenceImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	28252644
MIRT650678	hsa-miR-129-5p	HITS-CLIP	27418678
MIRT650679	hsa-miR-8055	HITS-CLIP	27418678
MIRT736194	hsa-miR-633	Luciferase reporter assayWestern blottingqRT-PCR	33376521
MIRT650687	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT650686	hsa-miR-4294	HITS-CLIP	23824327
MIRT650685	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT650684	hsa-miR-6888-3p	HITS-CLIP	23824327
MIRT650683	hsa-miR-3672	HITS-CLIP	23824327
MIRT650682	hsa-miR-6864-3p	HITS-CLIP	23824327
MIRT650681	hsa-miR-4743-3p	HITS-CLIP	23824327
MIRT650680	hsa-miR-4652-3p	HITS-CLIP	23824327
MIRT650679	hsa-miR-8055	HITS-CLIP	23824327
MIRT650678	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT876238	hsa-miR-1193	CLIP-seq
MIRT876239	hsa-miR-122	CLIP-seq
MIRT876240	hsa-miR-197	CLIP-seq
MIRT876241	hsa-miR-1976	CLIP-seq
MIRT876242	hsa-miR-2392	CLIP-seq
MIRT876243	hsa-miR-3135b	CLIP-seq
MIRT876244	hsa-miR-361-3p	CLIP-seq
MIRT876245	hsa-miR-3652	CLIP-seq
MIRT876246	hsa-miR-4258	CLIP-seq
MIRT876247	hsa-miR-4430	CLIP-seq
MIRT876248	hsa-miR-4532	CLIP-seq
MIRT876249	hsa-miR-4662a-5p	CLIP-seq
MIRT876250	hsa-miR-4676-5p	CLIP-seq
MIRT876251	hsa-miR-4707-3p	CLIP-seq
MIRT876252	hsa-miR-4716-5p	CLIP-seq
MIRT876253	hsa-miR-4772-3p	CLIP-seq
MIRT876254	hsa-miR-5096	CLIP-seq
MIRT876255	hsa-miR-513a-3p	CLIP-seq
MIRT876256	hsa-miR-572	CLIP-seq
MIRT876257	hsa-miR-575	CLIP-seq
MIRT876258	hsa-miR-640	CLIP-seq
MIRT876259	hsa-miR-106a	CLIP-seq
MIRT876260	hsa-miR-106b	CLIP-seq
MIRT876238	hsa-miR-1193	CLIP-seq
MIRT876239	hsa-miR-122	CLIP-seq
MIRT876261	hsa-miR-1234	CLIP-seq
MIRT876262	hsa-miR-150	CLIP-seq
MIRT876263	hsa-miR-17	CLIP-seq
MIRT876241	hsa-miR-1976	CLIP-seq
MIRT876264	hsa-miR-20a	CLIP-seq
MIRT876265	hsa-miR-20b	CLIP-seq
MIRT876266	hsa-miR-219-1-3p	CLIP-seq
MIRT876242	hsa-miR-2392	CLIP-seq
MIRT876267	hsa-miR-302a	CLIP-seq
MIRT876268	hsa-miR-302b	CLIP-seq
MIRT876269	hsa-miR-302c	CLIP-seq
MIRT876270	hsa-miR-302d	CLIP-seq
MIRT876271	hsa-miR-302e	CLIP-seq
MIRT876243	hsa-miR-3135b	CLIP-seq
MIRT876244	hsa-miR-361-3p	CLIP-seq
MIRT876245	hsa-miR-3652	CLIP-seq
MIRT876272	hsa-miR-372	CLIP-seq
MIRT876273	hsa-miR-373	CLIP-seq
MIRT876274	hsa-miR-3921	CLIP-seq
MIRT876247	hsa-miR-4430	CLIP-seq
MIRT876275	hsa-miR-4639-5p	CLIP-seq
MIRT876276	hsa-miR-4653-5p	CLIP-seq
MIRT876277	hsa-miR-4682	CLIP-seq
MIRT876278	hsa-miR-4731-5p	CLIP-seq
MIRT876279	hsa-miR-4768-5p	CLIP-seq
MIRT876280	hsa-miR-512-3p	CLIP-seq
MIRT876281	hsa-miR-519d	CLIP-seq
MIRT876282	hsa-miR-520a-3p	CLIP-seq
MIRT876283	hsa-miR-520b	CLIP-seq
MIRT876284	hsa-miR-520c-3p	CLIP-seq
MIRT876285	hsa-miR-520d-3p	CLIP-seq
MIRT876286	hsa-miR-520e	CLIP-seq
MIRT876287	hsa-miR-520g	CLIP-seq
MIRT876288	hsa-miR-520h	CLIP-seq
MIRT876289	hsa-miR-571	CLIP-seq
MIRT876258	hsa-miR-640	CLIP-seq
MIRT876290	hsa-miR-93	CLIP-seq
MIRT876238	hsa-miR-1193	CLIP-seq
MIRT876240	hsa-miR-197	CLIP-seq
MIRT876241	hsa-miR-1976	CLIP-seq
MIRT876242	hsa-miR-2392	CLIP-seq
MIRT1921544	hsa-miR-3149	CLIP-seq
MIRT1921545	hsa-miR-411	CLIP-seq
MIRT876249	hsa-miR-4662a-5p	CLIP-seq
MIRT876250	hsa-miR-4676-5p	CLIP-seq
MIRT876252	hsa-miR-4716-5p	CLIP-seq
MIRT1921546	hsa-miR-483-5p	CLIP-seq
MIRT876254	hsa-miR-5096	CLIP-seq
MIRT876257	hsa-miR-575	CLIP-seq
MIRT876258	hsa-miR-640	CLIP-seq
MIRT876238	hsa-miR-1193	CLIP-seq
MIRT876240	hsa-miR-197	CLIP-seq
MIRT876241	hsa-miR-1976	CLIP-seq
MIRT876242	hsa-miR-2392	CLIP-seq
MIRT1921544	hsa-miR-3149	CLIP-seq
MIRT1921545	hsa-miR-411	CLIP-seq
MIRT876249	hsa-miR-4662a-5p	CLIP-seq
MIRT876250	hsa-miR-4676-5p	CLIP-seq
MIRT876252	hsa-miR-4716-5p	CLIP-seq
MIRT1921546	hsa-miR-483-5p	CLIP-seq
MIRT876254	hsa-miR-5096	CLIP-seq
MIRT876257	hsa-miR-575	CLIP-seq
MIRT876258	hsa-miR-640	CLIP-seq
MIRT876238	hsa-miR-1193	CLIP-seq
MIRT876240	hsa-miR-197	CLIP-seq
MIRT876241	hsa-miR-1976	CLIP-seq
MIRT876242	hsa-miR-2392	CLIP-seq
MIRT1921544	hsa-miR-3149	CLIP-seq
MIRT1921545	hsa-miR-411	CLIP-seq
MIRT876249	hsa-miR-4662a-5p	CLIP-seq
MIRT876250	hsa-miR-4676-5p	CLIP-seq
MIRT876252	hsa-miR-4716-5p	CLIP-seq
MIRT1921546	hsa-miR-483-5p	CLIP-seq
MIRT876254	hsa-miR-5096	CLIP-seq
MIRT876257	hsa-miR-575	CLIP-seq
MIRT876258	hsa-miR-640	CLIP-seq
MIRT876262	hsa-miR-150	CLIP-seq
MIRT1959688	hsa-miR-552	CLIP-seq
MIRT876238	hsa-miR-1193	CLIP-seq
MIRT876239	hsa-miR-122	CLIP-seq
MIRT2196690	hsa-miR-1228	CLIP-seq
MIRT876262	hsa-miR-150	CLIP-seq
MIRT876240	hsa-miR-197	CLIP-seq
MIRT876242	hsa-miR-2392	CLIP-seq
MIRT876243	hsa-miR-3135b	CLIP-seq
MIRT2196691	hsa-miR-3199	CLIP-seq
MIRT876244	hsa-miR-361-3p	CLIP-seq
MIRT2196692	hsa-miR-3616-3p	CLIP-seq
MIRT876245	hsa-miR-3652	CLIP-seq
MIRT2196693	hsa-miR-377	CLIP-seq
MIRT2196694	hsa-miR-3927	CLIP-seq
MIRT1921545	hsa-miR-411	CLIP-seq
MIRT876246	hsa-miR-4258	CLIP-seq
MIRT876247	hsa-miR-4430	CLIP-seq
MIRT2196695	hsa-miR-4436b-3p	CLIP-seq
MIRT876248	hsa-miR-4532	CLIP-seq
MIRT2196696	hsa-miR-4650-3p	CLIP-seq
MIRT876249	hsa-miR-4662a-5p	CLIP-seq
MIRT876250	hsa-miR-4676-5p	CLIP-seq
MIRT2196697	hsa-miR-4690-3p	CLIP-seq
MIRT2196698	hsa-miR-4695-3p	CLIP-seq
MIRT876251	hsa-miR-4707-3p	CLIP-seq
MIRT876252	hsa-miR-4716-5p	CLIP-seq
MIRT2196699	hsa-miR-4721	CLIP-seq
MIRT2196700	hsa-miR-4736	CLIP-seq
MIRT1921546	hsa-miR-483-5p	CLIP-seq
MIRT876254	hsa-miR-5096	CLIP-seq
MIRT876255	hsa-miR-513a-3p	CLIP-seq
MIRT876287	hsa-miR-520g	CLIP-seq
MIRT876288	hsa-miR-520h	CLIP-seq
MIRT1959688	hsa-miR-552	CLIP-seq
MIRT2196701	hsa-miR-562	CLIP-seq
MIRT876257	hsa-miR-575	CLIP-seq
MIRT2196702	hsa-miR-764	CLIP-seq
MIRT876246	hsa-miR-4258	CLIP-seq
MIRT876251	hsa-miR-4707-3p	CLIP-seq
MIRT876255	hsa-miR-513a-3p	CLIP-seq
MIRT876239	hsa-miR-122	CLIP-seq
MIRT876243	hsa-miR-3135b	CLIP-seq
MIRT876244	hsa-miR-361-3p	CLIP-seq
MIRT876245	hsa-miR-3652	CLIP-seq
MIRT876246	hsa-miR-4258	CLIP-seq
MIRT876247	hsa-miR-4430	CLIP-seq
MIRT2196698	hsa-miR-4695-3p	CLIP-seq
MIRT876251	hsa-miR-4707-3p	CLIP-seq
MIRT876255	hsa-miR-513a-3p	CLIP-seq
MIRT876239	hsa-miR-122	CLIP-seq
MIRT876243	hsa-miR-3135b	CLIP-seq
MIRT876244	hsa-miR-361-3p	CLIP-seq
MIRT876245	hsa-miR-3652	CLIP-seq
MIRT876246	hsa-miR-4258	CLIP-seq
MIRT876247	hsa-miR-4430	CLIP-seq
MIRT876251	hsa-miR-4707-3p	CLIP-seq
MIRT876255	hsa-miR-513a-3p	CLIP-seq

Show/Hide all (6)

Transcription factor	Regulation	Reference
ATF3	Unknown	21454613
HDAC1	Repression	19182791
JUN	Activation	15580298
JUNB	Activation	15580298
TFAP2A	Activation	15580298
TP53	Activation	9736732

Show/Hide all (9)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	15205336, 28030805, 32296183
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	30463011
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	1842498, 7754374
GO:0016020	Component	Membrane	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0045335	Component	Phagocytic vesicle	IEA
GO:0070062	Component	Extracellular exosome	HDA	19199708, 20458337

MIM	HGNC	e!Ensembl
600623	6210	ENSG00000085117

P27701

Protein name

CD82 antigen (C33 antigen) (IA4) (Inducible membrane protein R2) (Metastasis suppressor Kangai-1) (Suppressor of tumorigenicity 6 protein) (Tetraspanin-27) (Tspan-27) (CD antigen CD82)

Protein function

Structural component of specialized membrane microdomains known as tetraspanin-enriched microdomains (TERMs), which act as platforms for receptor clustering and signaling (PubMed:19497983). Participates thereby in diverse biological functions su

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00335	Tetraspanin	9 → 255	Tetraspanin family	Family

Tissue specificity

TISSUE SPECIFICITY: Lymphoid specific.

Sequence

MGSACIKVTKYFLFLFNLIFFILGAVILGFGVWILADKSSFISVLQTSSSSLRMGAYVFI
GVGAVTMLMGFLGCIGAVNEVRCLLGLYFAFLLLILIAQVTAGALFYFNMGKLKQEMGGI
VTELIRDYNSSREDSLQDAWDYVQAQVKCCGWVSFYNWTDNAELMNRPEVTYPCSCEVKG
EEDNSLSVRKGFCEAPGNRTQSGNHPEDWPVYQEGCMEKVQAWLQENLGIILGVGVGVAI
IELLGMVLSICLCRHVHSEDYSKVPKY

Sequence length

267

Interactions

View interactions

	KEGG
	p53 signaling pathway

Show/Hide Unknown Diseases (7)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Acute myeloid leukemia	Benign	rs79095986	RCV005908380
Cervical cancer	Benign	rs79095986	RCV005908382
Clear cell carcinoma of kidney	Benign	rs79095986	RCV005908383
Lung cancer	Benign	rs79095986	RCV005908385
Nonpapillary renal cell carcinoma	Benign	rs79095986	RCV005908381
Sarcoma	Benign	rs79095986	RCV005908384
Uterine corpus endometrial carcinoma	Benign	rs79095986	RCV005908386

Show/Hide Text Mining Associations (70)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Adenocarcinoma	Inhibit	16698949
Adenocarcinoma of Lung	Associate	36595821
Arthritis Rheumatoid	Associate	17393418
Atherosclerosis	Associate	35795669
Brain Neoplasms	Inhibit	15592684
Breast Diseases	Associate	9570365
Breast Neoplasms	Associate	15592684, 19549254, 32986351, 9570365, 9736046
Breast Neoplasms	Inhibit	22320993, 27509988, 31759355, 32986351, 34207462
Burkitt Lymphoma	Associate	9737661
Calcinosis Cutis	Inhibit	27509988
Carcinoma	Inhibit	10985391
Carcinoma Adenosquamous	Associate	11696423
Carcinoma Ductal	Associate	25889325
Carcinoma Hepatocellular	Associate	25071074
Carcinoma Non Small Cell Lung	Associate	19152459, 26231404, 30593175, 9570365
Carcinoma Ovarian Epithelial	Associate	31725636
Carcinoma Pancreatic Ductal	Associate	28030805
Carcinoma Renal Cell	Associate	19680475
Carcinoma Squamous Cell	Inhibit	11696423
Carcinoma Squamous Cell	Associate	34065085
Colorectal Neoplasms	Associate	12838318, 24603753, 26408312, 27053631, 28431527, 33891491
Colorectal Neoplasms	Inhibit	35942551
Coronary Artery Disease	Associate	35795669
Diabetes Mellitus	Associate	33909846
Endometrial Neoplasms	Associate	25308734
Esophageal Squamous Cell Carcinoma	Associate	10098753, 30280774
Food Hypersensitivity	Associate	30120223
Glioma	Associate	27764516
Head and Neck Neoplasms	Associate	22320990
Inflammation	Associate	30120223
Laryngeal Neoplasms	Associate	22320990
Leukemia	Associate	25955299, 27417454
Leukemia Lymphocytic Chronic B Cell	Stimulate	10583248
Leukemia Myeloid Acute	Associate	23233446, 25955299, 26592446, 27417454, 32203165, 34543390
Leukemia Prolymphocytic T Cell	Stimulate	10583248
Leukemia T Cell	Stimulate	10583248
Lung Neoplasms	Associate	26132195, 34684727
Lymphatic Metastasis	Associate	10098753, 26231404, 26681053, 27793161, 28431527, 30593175, 31725636, 31759355
Lymphatic Metastasis	Inhibit	17504447, 23696923, 24758564, 25889325, 26408312, 29187211, 30280774
Lymphoma B Cell Marginal Zone	Associate	22110251
Lymphoma T Cell Cutaneous	Associate	35947128
Melanoma	Associate	26246476, 35942551
Multiple Myeloma	Associate	19755988
Myelodysplastic Syndromes	Associate	34543390
Neoplasm Metastasis	Inhibit	10098753, 10692390, 10985391, 11696423, 12738793, 14706010, 15592684, 15677461, 19048121, 19116362, 19182791, 19549254, 19619280, 22320993, 22684230 View all (20 more)
Neoplasm Metastasis	Associate	17504447, 19152459, 23696923, 23886139, 24758564, 26408312, 26681053, 37990044
Neoplasms	Inhibit	10098753, 12738793, 15677461, 19549254, 21521534, 22679510, 22684230, 24901051, 26132195, 26246476, 26681053, 27764516, 27926483, 30280774, 30593175 View all (5 more)
Neoplasms	Associate	10985391, 12838318, 14514775, 14706010, 19116362, 23076981, 24758564, 25308734, 25889325, 25955299, 26231404, 27610644, 27793161, 28431527, 30005669 View all (8 more)
Non alcoholic Fatty Liver Disease	Associate	31483122
Ovarian Neoplasms	Inhibit	11696423
Pancreatic Neoplasms	Associate	28030805, 31662449
Papillary Thyroid Microcarcinoma	Associate	30794730
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Stimulate	10583248
Prostate cancer familial	Inhibit	9736732
Prostatic Hyperplasia	Associate	8909232
Prostatic Neoplasms	Associate	12738793, 31759355, 33204367, 8909232, 9570365
Prostatic Neoplasms	Inhibit	27926483
Prostatitis	Associate	27509988
Prostatitis	Inhibit	27926483
Squamous Cell Carcinoma of Head and Neck	Associate	23696923, 23886139, 29187211
Squamous Cell Carcinoma of Head and Neck	Inhibit	24758564
Stomach Neoplasms	Associate	17504447, 21521534, 28252644
Stomach Neoplasms	Inhibit	27793161
Stomach Ulcer	Associate	21521534
Syndrome	Associate	27610644
Tertiary Lymphoid Structures	Associate	22684230
Thrombosis	Associate	25071074
Urinary Bladder Neoplasms	Associate	14706010
Uterine Cervical Neoplasms	Inhibit	11696423, 26681053
Uterine Cervicitis	Inhibit	26681053

CD82 (CD82 molecule)