Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	3727
Gene name Gene Name - the full gene name approved by the HGNC.	JunD proto-oncogene, AP-1 transcription factor subunit
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	JUND
Synonyms (NCBI Gene) Gene synonyms aliases	AP-1
Chromosome Chromosome number	19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	19p13.11
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this intronless gene is a member of the JUN family, and a functional component of the AP1 transcription factor complex. This protein has been proposed to protect cells from p53-dependent senescence and apoptosis. Alternative transla

Show/Hide all(257)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005354	hsa-miR-663a	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	20622002
MIRT005354	hsa-miR-663a	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	20622002
MIRT017287	hsa-miR-335-5p	Microarray	18185580
MIRT045282	hsa-miR-186-5p	CLASH	23622248
MIRT650156	hsa-miR-4778-3p	HITS-CLIP	23824327
MIRT650155	hsa-miR-6875-3p	HITS-CLIP	23824327
MIRT491193	hsa-miR-3173-3p	PAR-CLIP	20371350
MIRT491191	hsa-miR-6891-5p	PAR-CLIP	20371350
MIRT570207	hsa-miR-4695-5p	PAR-CLIP	20371350
MIRT570208	hsa-miR-4707-5p	PAR-CLIP	20371350
MIRT491190	hsa-miR-3185	PAR-CLIP	20371350
MIRT491189	hsa-miR-4755-3p	PAR-CLIP	20371350
MIRT491188	hsa-miR-1908-5p	PAR-CLIP	20371350
MIRT005354	hsa-miR-663a	PAR-CLIP	20371350
MIRT491187	hsa-miR-6787-5p	PAR-CLIP	20371350
MIRT491186	hsa-miR-4271	PAR-CLIP	20371350
MIRT491185	hsa-miR-4725-3p	PAR-CLIP	20371350
MIRT491183	hsa-miR-6780b-5p	PAR-CLIP	20371350
MIRT570206	hsa-miR-625-5p	PAR-CLIP	20371350
MIRT491193	hsa-miR-3173-3p	PAR-CLIP	23592263
MIRT491191	hsa-miR-6891-5p	PAR-CLIP	23592263
MIRT491190	hsa-miR-3185	PAR-CLIP	23592263
MIRT491189	hsa-miR-4755-3p	PAR-CLIP	23592263
MIRT491188	hsa-miR-1908-5p	PAR-CLIP	23592263
MIRT005354	hsa-miR-663a	PAR-CLIP	23592263
MIRT491187	hsa-miR-6787-5p	PAR-CLIP	23592263
MIRT491186	hsa-miR-4271	PAR-CLIP	23592263
MIRT491185	hsa-miR-4725-3p	PAR-CLIP	23592263
MIRT491183	hsa-miR-6780b-5p	PAR-CLIP	23592263
MIRT005354	hsa-miR-663a	Luciferase reporter assay, Western blot	27184257
MIRT005354	hsa-miR-663a	Luciferase reporter assay, Western blot	27184257
MIRT491188	hsa-miR-1908-5p	PAR-CLIP	26701625
MIRT570206	hsa-miR-625-5p	PAR-CLIP	26701625
MIRT005354	hsa-miR-663a	PAR-CLIP	26701625
MIRT491187	hsa-miR-6787-5p	PAR-CLIP	26701625
MIRT650156	hsa-miR-4778-3p	HITS-CLIP	23824327
MIRT650155	hsa-miR-6875-3p	HITS-CLIP	23824327
MIRT491193	hsa-miR-3173-3p	PAR-CLIP	20371350
MIRT491191	hsa-miR-6891-5p	PAR-CLIP	20371350
MIRT570207	hsa-miR-4695-5p	PAR-CLIP	20371350
MIRT570208	hsa-miR-4707-5p	PAR-CLIP	20371350
MIRT491190	hsa-miR-3185	PAR-CLIP	20371350
MIRT491189	hsa-miR-4755-3p	PAR-CLIP	20371350
MIRT491188	hsa-miR-1908-5p	PAR-CLIP	20371350
MIRT005354	hsa-miR-663a	PAR-CLIP	20371350
MIRT491187	hsa-miR-6787-5p	PAR-CLIP	20371350
MIRT491186	hsa-miR-4271	PAR-CLIP	20371350
MIRT491185	hsa-miR-4725-3p	PAR-CLIP	20371350
MIRT491183	hsa-miR-6780b-5p	PAR-CLIP	20371350
MIRT570206	hsa-miR-625-5p	PAR-CLIP	20371350
MIRT491193	hsa-miR-3173-3p	PAR-CLIP	23592263
MIRT491191	hsa-miR-6891-5p	PAR-CLIP	23592263
MIRT491190	hsa-miR-3185	PAR-CLIP	23592263
MIRT491189	hsa-miR-4755-3p	PAR-CLIP	23592263
MIRT491188	hsa-miR-1908-5p	PAR-CLIP	23592263
MIRT005354	hsa-miR-663a	PAR-CLIP	23592263
MIRT491187	hsa-miR-6787-5p	PAR-CLIP	23592263
MIRT491186	hsa-miR-4271	PAR-CLIP	23592263
MIRT491185	hsa-miR-4725-3p	PAR-CLIP	23592263
MIRT491183	hsa-miR-6780b-5p	PAR-CLIP	23592263
MIRT1078219	hsa-miR-1	CLIP-seq
MIRT1078220	hsa-miR-1321	CLIP-seq
MIRT1078221	hsa-miR-139-3p	CLIP-seq
MIRT1078222	hsa-miR-19a	CLIP-seq
MIRT1078223	hsa-miR-19b	CLIP-seq
MIRT1078224	hsa-miR-206	CLIP-seq
MIRT1078225	hsa-miR-2110	CLIP-seq
MIRT1078226	hsa-miR-2113	CLIP-seq
MIRT1078227	hsa-miR-2116	CLIP-seq
MIRT1078228	hsa-miR-3121-3p	CLIP-seq
MIRT1078229	hsa-miR-3133	CLIP-seq
MIRT1078230	hsa-miR-3138	CLIP-seq
MIRT1078231	hsa-miR-3144-5p	CLIP-seq
MIRT1078232	hsa-miR-3150a-3p	CLIP-seq
MIRT1078233	hsa-miR-3159	CLIP-seq
MIRT1078234	hsa-miR-3175	CLIP-seq
MIRT1078235	hsa-miR-3177-5p	CLIP-seq
MIRT1078236	hsa-miR-3183	CLIP-seq
MIRT1078237	hsa-miR-3189-3p	CLIP-seq
MIRT1078238	hsa-miR-3664-5p	CLIP-seq
MIRT1078239	hsa-miR-375	CLIP-seq
MIRT1078240	hsa-miR-3921	CLIP-seq
MIRT1078241	hsa-miR-4436b-3p	CLIP-seq
MIRT1078242	hsa-miR-4487	CLIP-seq
MIRT1078243	hsa-miR-4491	CLIP-seq
MIRT1078244	hsa-miR-4532	CLIP-seq
MIRT1078245	hsa-miR-4653-5p	CLIP-seq
MIRT1078246	hsa-miR-4657	CLIP-seq
MIRT1078247	hsa-miR-4659a-3p	CLIP-seq
MIRT1078248	hsa-miR-4659b-3p	CLIP-seq
MIRT1078249	hsa-miR-4677-5p	CLIP-seq
MIRT1078250	hsa-miR-4682	CLIP-seq
MIRT1078251	hsa-miR-4688	CLIP-seq
MIRT1078252	hsa-miR-4707-3p	CLIP-seq
MIRT1078253	hsa-miR-4723-3p	CLIP-seq
MIRT1078254	hsa-miR-4724-5p	CLIP-seq
MIRT1078255	hsa-miR-4728-5p	CLIP-seq
MIRT1078256	hsa-miR-4731-3p	CLIP-seq
MIRT1078257	hsa-miR-4739	CLIP-seq
MIRT1078258	hsa-miR-4740-3p	CLIP-seq
MIRT1078259	hsa-miR-4756-5p	CLIP-seq
MIRT1078260	hsa-miR-4761-3p	CLIP-seq
MIRT1078261	hsa-miR-4787-3p	CLIP-seq
MIRT1078262	hsa-miR-4800-5p	CLIP-seq
MIRT1078263	hsa-miR-4801	CLIP-seq
MIRT1078264	hsa-miR-4803	CLIP-seq
MIRT1078265	hsa-miR-486-3p	CLIP-seq
MIRT1078266	hsa-miR-494	CLIP-seq
MIRT1078267	hsa-miR-520d-5p	CLIP-seq
MIRT1078268	hsa-miR-524-5p	CLIP-seq
MIRT1078269	hsa-miR-548aa	CLIP-seq
MIRT1078270	hsa-miR-548ac	CLIP-seq
MIRT1078271	hsa-miR-548b-3p	CLIP-seq
MIRT1078272	hsa-miR-548d-3p	CLIP-seq
MIRT1078273	hsa-miR-548p	CLIP-seq
MIRT1078274	hsa-miR-548z	CLIP-seq
MIRT1078275	hsa-miR-570	CLIP-seq
MIRT1078276	hsa-miR-602	CLIP-seq
MIRT1078277	hsa-miR-613	CLIP-seq
MIRT1078278	hsa-miR-939	CLIP-seq
MIRT1078219	hsa-miR-1	CLIP-seq
MIRT1078221	hsa-miR-139-3p	CLIP-seq
MIRT2019494	hsa-miR-1908	CLIP-seq
MIRT2019495	hsa-miR-1909	CLIP-seq
MIRT1078222	hsa-miR-19a	CLIP-seq
MIRT1078223	hsa-miR-19b	CLIP-seq
MIRT1078224	hsa-miR-206	CLIP-seq
MIRT1078226	hsa-miR-2113	CLIP-seq
MIRT1078230	hsa-miR-3138	CLIP-seq
MIRT1078233	hsa-miR-3159	CLIP-seq
MIRT1078235	hsa-miR-3177-5p	CLIP-seq
MIRT2019496	hsa-miR-3180	CLIP-seq
MIRT2019497	hsa-miR-3180-3p	CLIP-seq
MIRT2019498	hsa-miR-3196	CLIP-seq
MIRT2019499	hsa-miR-3655	CLIP-seq
MIRT2019500	hsa-miR-4267	CLIP-seq
MIRT1078243	hsa-miR-4491	CLIP-seq
MIRT1078246	hsa-miR-4657	CLIP-seq
MIRT1078247	hsa-miR-4659a-3p	CLIP-seq
MIRT1078248	hsa-miR-4659b-3p	CLIP-seq
MIRT1078251	hsa-miR-4688	CLIP-seq
MIRT2019501	hsa-miR-4787-5p	CLIP-seq
MIRT1078262	hsa-miR-4800-5p	CLIP-seq
MIRT1078265	hsa-miR-486-3p	CLIP-seq
MIRT1078267	hsa-miR-520d-5p	CLIP-seq
MIRT1078268	hsa-miR-524-5p	CLIP-seq
MIRT1078270	hsa-miR-548ac	CLIP-seq
MIRT1078272	hsa-miR-548d-3p	CLIP-seq
MIRT1078274	hsa-miR-548z	CLIP-seq
MIRT1078275	hsa-miR-570	CLIP-seq
MIRT1078276	hsa-miR-602	CLIP-seq
MIRT1078277	hsa-miR-613	CLIP-seq
MIRT2019502	hsa-miR-615-5p	CLIP-seq
MIRT2019503	hsa-miR-625	CLIP-seq
MIRT2019504	hsa-miR-663	CLIP-seq
MIRT2019505	hsa-miR-937	CLIP-seq
MIRT1078219	hsa-miR-1	CLIP-seq
MIRT2251331	hsa-miR-1236	CLIP-seq
MIRT2019494	hsa-miR-1908	CLIP-seq
MIRT1078222	hsa-miR-19a	CLIP-seq
MIRT1078223	hsa-miR-19b	CLIP-seq
MIRT1078224	hsa-miR-206	CLIP-seq
MIRT1078226	hsa-miR-2113	CLIP-seq
MIRT1078227	hsa-miR-2116	CLIP-seq
MIRT1078228	hsa-miR-3121-3p	CLIP-seq
MIRT1078233	hsa-miR-3159	CLIP-seq
MIRT2019496	hsa-miR-3180	CLIP-seq
MIRT2019497	hsa-miR-3180-3p	CLIP-seq
MIRT2019498	hsa-miR-3196	CLIP-seq
MIRT1078238	hsa-miR-3664-5p	CLIP-seq
MIRT1078239	hsa-miR-375	CLIP-seq
MIRT2019500	hsa-miR-4267	CLIP-seq
MIRT1078241	hsa-miR-4436b-3p	CLIP-seq
MIRT1078247	hsa-miR-4659a-3p	CLIP-seq
MIRT1078248	hsa-miR-4659b-3p	CLIP-seq
MIRT1078249	hsa-miR-4677-5p	CLIP-seq
MIRT1078254	hsa-miR-4724-5p	CLIP-seq
MIRT1078258	hsa-miR-4740-3p	CLIP-seq
MIRT1078260	hsa-miR-4761-3p	CLIP-seq
MIRT2251332	hsa-miR-4768-5p	CLIP-seq
MIRT1078264	hsa-miR-4803	CLIP-seq
MIRT1078267	hsa-miR-520d-5p	CLIP-seq
MIRT1078268	hsa-miR-524-5p	CLIP-seq
MIRT1078275	hsa-miR-570	CLIP-seq
MIRT1078276	hsa-miR-602	CLIP-seq
MIRT1078277	hsa-miR-613	CLIP-seq
MIRT2019502	hsa-miR-615-5p	CLIP-seq
MIRT2019503	hsa-miR-625	CLIP-seq
MIRT2019504	hsa-miR-663	CLIP-seq
MIRT2251333	hsa-miR-942	CLIP-seq
MIRT2389576	hsa-miR-1285	CLIP-seq
MIRT2389577	hsa-miR-1343	CLIP-seq
MIRT1078222	hsa-miR-19a	CLIP-seq
MIRT1078223	hsa-miR-19b	CLIP-seq
MIRT1078226	hsa-miR-2113	CLIP-seq
MIRT2389578	hsa-miR-3187-5p	CLIP-seq
MIRT2019499	hsa-miR-3655	CLIP-seq
MIRT2389579	hsa-miR-612	CLIP-seq
MIRT1078219	hsa-miR-1	CLIP-seq
MIRT1078220	hsa-miR-1321	CLIP-seq
MIRT2554640	hsa-miR-151-5p	CLIP-seq
MIRT2554641	hsa-miR-151b	CLIP-seq
MIRT1078224	hsa-miR-206	CLIP-seq
MIRT1078228	hsa-miR-3121-3p	CLIP-seq
MIRT2554642	hsa-miR-3131	CLIP-seq
MIRT1078229	hsa-miR-3133	CLIP-seq
MIRT1078230	hsa-miR-3138	CLIP-seq
MIRT1078231	hsa-miR-3144-5p	CLIP-seq
MIRT1078233	hsa-miR-3159	CLIP-seq
MIRT2554643	hsa-miR-3179	CLIP-seq
MIRT2019496	hsa-miR-3180	CLIP-seq
MIRT2019497	hsa-miR-3180-3p	CLIP-seq
MIRT2019498	hsa-miR-3196	CLIP-seq
MIRT2554644	hsa-miR-3613-3p	CLIP-seq
MIRT1078241	hsa-miR-4436b-3p	CLIP-seq
MIRT1078243	hsa-miR-4491	CLIP-seq
MIRT1078246	hsa-miR-4657	CLIP-seq
MIRT2554645	hsa-miR-4723-5p	CLIP-seq
MIRT1078255	hsa-miR-4728-5p	CLIP-seq
MIRT1078257	hsa-miR-4739	CLIP-seq
MIRT1078258	hsa-miR-4740-3p	CLIP-seq
MIRT1078259	hsa-miR-4756-5p	CLIP-seq
MIRT1078260	hsa-miR-4761-3p	CLIP-seq
MIRT1078262	hsa-miR-4800-5p	CLIP-seq
MIRT1078264	hsa-miR-4803	CLIP-seq
MIRT1078266	hsa-miR-494	CLIP-seq
MIRT1078267	hsa-miR-520d-5p	CLIP-seq
MIRT1078268	hsa-miR-524-5p	CLIP-seq
MIRT1078271	hsa-miR-548b-3p	CLIP-seq
MIRT1078273	hsa-miR-548p	CLIP-seq
MIRT1078275	hsa-miR-570	CLIP-seq
MIRT2554646	hsa-miR-611	CLIP-seq
MIRT1078277	hsa-miR-613	CLIP-seq
MIRT1078278	hsa-miR-939	CLIP-seq
MIRT1078219	hsa-miR-1	CLIP-seq
MIRT1078220	hsa-miR-1321	CLIP-seq
MIRT1078224	hsa-miR-206	CLIP-seq
MIRT1078229	hsa-miR-3133	CLIP-seq
MIRT1078230	hsa-miR-3138	CLIP-seq
MIRT1078231	hsa-miR-3144-5p	CLIP-seq
MIRT1078233	hsa-miR-3159	CLIP-seq
MIRT2554643	hsa-miR-3179	CLIP-seq
MIRT2554644	hsa-miR-3613-3p	CLIP-seq
MIRT1078243	hsa-miR-4491	CLIP-seq
MIRT1078246	hsa-miR-4657	CLIP-seq
MIRT2554645	hsa-miR-4723-5p	CLIP-seq
MIRT1078255	hsa-miR-4728-5p	CLIP-seq
MIRT1078257	hsa-miR-4739	CLIP-seq
MIRT1078259	hsa-miR-4756-5p	CLIP-seq
MIRT1078262	hsa-miR-4800-5p	CLIP-seq
MIRT1078267	hsa-miR-520d-5p	CLIP-seq
MIRT1078268	hsa-miR-524-5p	CLIP-seq
MIRT1078271	hsa-miR-548b-3p	CLIP-seq
MIRT1078273	hsa-miR-548p	CLIP-seq
MIRT1078275	hsa-miR-570	CLIP-seq
MIRT1078277	hsa-miR-613	CLIP-seq
MIRT1078278	hsa-miR-939	CLIP-seq

Transcription factors

Show/Hide all(3)

Transcription factor	Regulation	Reference
MEN1	Repression	22327296
RBMX	Repression	16707624
ZIC1	Activation	20713527

Show/Hide all(56)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	22327296
GO:0000785	Component	Chromatin	ISA
GO:0000785	Component	Chromatin	TAS	1903194
GO:0000976	Function	Transcription cis-regulatory region binding	IDA	1903194
GO:0000976	Function	Transcription cis-regulatory region binding	IEA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001221	Function	Transcription coregulator binding	IEA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0002076	Process	Osteoblast development	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003690	Function	Double-stranded DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003713	Function	Transcription coactivator activity	IEA
GO:0005515	Function	Protein binding	IPI	9989505, 17577209, 20102225, 20195357, 22327296, 23784080, 24029232, 25609649, 26496610, 28514442, 30833792, 32814053, 33961781, 35140242
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	20102225
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005667	Component	Transcription regulator complex	IBA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	NAS	20102225
GO:0006357	Process	Regulation of transcription by RNA polymerase II	TAS	1903194
GO:0006366	Process	Transcription by RNA polymerase II	IEA
GO:0007623	Process	Circadian rhythm	IEA
GO:0009416	Process	Response to light stimulus	IEA
GO:0009612	Process	Response to mechanical stimulus	IEA
GO:0010467	Process	Gene expression	IEA
GO:0016922	Function	Nuclear receptor binding	IEA
GO:0017053	Component	Transcription repressor complex	IPI	22327296
GO:0019899	Function	Enzyme binding	IPI	23382074
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0032991	Component	Protein-containing complex	IEA
GO:0032993	Component	Protein-DNA complex	IEA
GO:0035360	Process	Positive regulation of peroxisome proliferator activated receptor signaling pathway	IEA
GO:0035976	Component	Transcription factor AP-1 complex	IDA	10508860
GO:0035976	Component	Transcription factor AP-1 complex	IEA
GO:0042127	Process	Regulation of cell population proliferation	IBA
GO:0043032	Process	Positive regulation of macrophage activation	IEA
GO:0043434	Process	Response to peptide hormone	IEA
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0045669	Process	Positive regulation of osteoblast differentiation	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	10508860
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0048545	Process	Response to steroid hormone	IBA
GO:0051726	Process	Regulation of cell cycle	IBA
GO:0071277	Process	Cellular response to calcium ion	IEA
GO:0071398	Process	Cellular response to fatty acid	IEA
GO:0071456	Process	Cellular response to hypoxia	IEA
GO:0090575	Component	RNA polymerase II transcription regulator complex	IPI	20102225
GO:1904321	Process	Response to forskolin	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

MIM	HGNC	e!Ensembl
165162	6206	ENSG00000130522

Protein

UniProt ID

P17535

Protein name

Transcription factor JunD (Transcription factor AP-1 subunit JunD)

Protein function

Transcription factor binding AP-1 sites (PubMed:9989505). Heterodimerizes with proteins of the FOS family to form an AP-1 transcription factor complex, thereby enhancing their DNA binding activity to an AP-1 consensus sequence 3'-TGA[GC]TCA-5' a

PDB

3U86 , 5VPA , 5VPB , 5VPC , 5VPD , 5VPE , 5VPF , 7UCC , 7UCD

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03957	Jun	1 → 257	Jun-like transcription factor	Family
PF00170	bZIP_1	266 → 329	bZIP transcription factor	Coiled-coil

Sequence

METPFYGDEALSGLGGGASGSGGSFASPGRLFPGAPPTAAAGSMMKKDALTLSLSEQVAA
ALKPAAAPPPTPLRADGAPSAAPPDGLLASPDLGLLKLASPELERLIIQSNGLVTTTPTS
SQFLYPKVAASEEQEFAEGFVKALEDLHKQNQLGAGAAAAAAAAAAGGPSGTATGSAPPG
ELAPAAAAPEAPVYANLSSYAGGAGGAGGAATVAFAAEPVPFPPPPPPGALGPPRLAALK
DEPQTVPDVPSFGESPPLSPIDMDTQERIKAERKRLRNRIAASKCRKRKLERISRLEEKV
KTLKSQNTELASTASLLREQVAQLKQKVLSHVNSGCQLLPQHQVPAY

Sequence length

347

Interactions

View interactions

	KEGG		Reactome
	MAPK signaling pathway Osteoclast differentiation IL-17 signaling pathway Parathyroid hormone synthesis, secretion and action		Estrogen-dependent gene expression NGF-stimulated transcription

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Systemic lupus erythematosus	Systemic lupus erythematosus	N/A	N/A	GWAS

Show/Hide Text Mining Associations (51)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Alzheimer Disease	Associate	37933012
Arthritis Rheumatoid	Associate	23072510
Breast Neoplasms	Associate	17166846, 21393445, 22988241, 28212576, 30337371
Cachexia	Inhibit	19470832
Carcinogenesis	Associate	23496845, 25332240
Carcinoid Tumor	Associate	18655788
Carcinoma Hepatocellular	Associate	18644981, 24659263, 25522777, 30382079
Carcinoma Pancreatic Ductal	Associate	36889906
Carcinoma Squamous Cell	Associate	11792626
Cholangiocarcinoma	Associate	36400758
Colorectal Neoplasms	Associate	24151146, 26625825, 33413550, 35697349
COVID 19	Associate	34312772
Death	Associate	23376981
Diabetes Mellitus	Associate	34801581
Diabetic Cardiomyopathies	Associate	34801581
Down Syndrome	Associate	16100769, 30763715
Dystonic Disorders	Associate	35941657
Glioblastoma	Associate	19276385, 27076368
Hypoxia	Stimulate	10487833
Hypoxia Brain	Stimulate	8065332
Inflammation	Associate	23072510, 36986236
Leukemia	Associate	10845928
Leukemia Hairy Cell	Associate	12576324
Leukemia Lymphoma Adult T Cell	Associate	10845928, 18078517, 23482931
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	7649976
Leukemia Myeloid Acute	Associate	12082101
Lung Neoplasms	Associate	10823417, 27184257, 37894738
Lymphoma B Cell Marginal Zone	Associate	15507668
Lymphoma Large B Cell Diffuse	Stimulate	26747248
Lymphoma T Cell Cutaneous	Associate	9864169
Melanoma	Associate	14717848, 35926467
Mouth Neoplasms	Associate	23324604, 28155253
Multiple Endocrine Neoplasia Type 1	Associate	23376981
Multiple Myeloma	Associate	12969976
Muscular Atrophy	Associate	19470832
Nasopharyngeal Carcinoma	Associate	23496845
Necrosis	Stimulate	27076368
Neoplasm Metastasis	Associate	36400758
Neoplasms	Associate	16265353, 18655788, 19602461, 19758438, 21734453, 22853846, 23772146, 24073962, 24659263, 26832411, 28155253, 31766230, 39342037
Neurodegenerative Diseases	Associate	34312772
Osteoarthritis	Associate	30081074
Pancreatic Neoplasms	Stimulate	17912030
Pancreatic Neoplasms	Associate	19435822, 36889906
Prostatic Neoplasms	Associate	20460526, 21622724, 21734453, 24647988, 26732163, 27358408, 30763715
Prostatitis	Associate	30763715
Renal Insufficiency Chronic	Associate	37933012
Scleroderma Systemic	Associate	32977850
Squamous Cell Carcinoma of Head and Neck	Associate	22853846
Stomach Neoplasms	Associate	1331059
Urinary Bladder Neoplasms	Associate	31906413
Uterine Cervical Neoplasms	Associate	21937452

JUND (JunD proto-oncogene, AP-1 transcription factor subunit)