Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	3726
Gene name Gene Name - the full gene name approved by the HGNC.	JunB proto-oncogene, AP-1 transcription factor subunit
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	JUNB
Synonyms (NCBI Gene) Gene synonyms aliases	AP-1
Chromosome Chromosome number	19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	19p13.13

Show/Hide all(184)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004391	hsa-miR-199a-5p	Microarray, Northern blot	16331254
MIRT000783	hsa-miR-199a-3p	Microarray, Northern blot	16331254
MIRT005353	hsa-miR-663a	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	20622002
MIRT005353	hsa-miR-663a	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	20622002
MIRT005353	hsa-miR-663a	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	20622002
MIRT005353	hsa-miR-663a	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	20622002
MIRT020720	hsa-miR-155-5p	Proteomics	18668040
MIRT036441	hsa-miR-1226-3p	CLASH	23622248
MIRT005353	hsa-miR-663a	Luciferase reporter assay, qRT-PCR, Western blot	24014830
MIRT004391	hsa-miR-199a-5p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	25938468
MIRT004391	hsa-miR-199a-5p	PAR-CLIP	26701625
MIRT004391	hsa-miR-199a-5p	PAR-CLIP	26701625
MIRT004391	hsa-miR-199a-5p	PAR-CLIP	26701625
MIRT004391	hsa-miR-199a-5p	PAR-CLIP	26701625
MIRT004391	hsa-miR-199a-5p	PAR-CLIP	26701625
MIRT1078170	hsa-miR-101	CLIP-seq
MIRT1078171	hsa-miR-1236	CLIP-seq
MIRT1078172	hsa-miR-1273g	CLIP-seq
MIRT1078173	hsa-miR-1303	CLIP-seq
MIRT1078174	hsa-miR-1908	CLIP-seq
MIRT1078175	hsa-miR-1911	CLIP-seq
MIRT1078176	hsa-miR-1915	CLIP-seq
MIRT1078177	hsa-miR-2467-3p	CLIP-seq
MIRT1078178	hsa-miR-302a	CLIP-seq
MIRT1078179	hsa-miR-302b	CLIP-seq
MIRT1078180	hsa-miR-302c	CLIP-seq
MIRT1078181	hsa-miR-302d	CLIP-seq
MIRT1078182	hsa-miR-302e	CLIP-seq
MIRT1078183	hsa-miR-30a	CLIP-seq
MIRT1078184	hsa-miR-30b	CLIP-seq
MIRT1078185	hsa-miR-30c	CLIP-seq
MIRT1078186	hsa-miR-30d	CLIP-seq
MIRT1078187	hsa-miR-30e	CLIP-seq
MIRT1078188	hsa-miR-3127-3p	CLIP-seq
MIRT1078189	hsa-miR-3179	CLIP-seq
MIRT1078190	hsa-miR-3190	CLIP-seq
MIRT1078191	hsa-miR-339-5p	CLIP-seq
MIRT1078192	hsa-miR-3616-3p	CLIP-seq
MIRT1078193	hsa-miR-3676	CLIP-seq
MIRT1078194	hsa-miR-3678-3p	CLIP-seq
MIRT1078195	hsa-miR-3692	CLIP-seq
MIRT1078196	hsa-miR-372	CLIP-seq
MIRT1078197	hsa-miR-373	CLIP-seq
MIRT1078198	hsa-miR-3937	CLIP-seq
MIRT1078199	hsa-miR-4267	CLIP-seq
MIRT1078200	hsa-miR-4313	CLIP-seq
MIRT1078201	hsa-miR-4467	CLIP-seq
MIRT1078202	hsa-miR-4640-5p	CLIP-seq
MIRT1078203	hsa-miR-4726-3p	CLIP-seq
MIRT1078204	hsa-miR-4726-5p	CLIP-seq
MIRT1078205	hsa-miR-4728-5p	CLIP-seq
MIRT1078206	hsa-miR-4743	CLIP-seq
MIRT1078207	hsa-miR-4787-5p	CLIP-seq
MIRT1078208	hsa-miR-519a	CLIP-seq
MIRT1078209	hsa-miR-519b-3p	CLIP-seq
MIRT1078210	hsa-miR-519c-3p	CLIP-seq
MIRT1078211	hsa-miR-520a-3p	CLIP-seq
MIRT1078212	hsa-miR-520b	CLIP-seq
MIRT1078213	hsa-miR-520c-3p	CLIP-seq
MIRT1078214	hsa-miR-520d-3p	CLIP-seq
MIRT1078215	hsa-miR-520e	CLIP-seq
MIRT1078216	hsa-miR-615-5p	CLIP-seq
MIRT1078217	hsa-miR-663	CLIP-seq
MIRT1078218	hsa-miR-744	CLIP-seq
MIRT1078170	hsa-miR-101	CLIP-seq
MIRT1078177	hsa-miR-2467-3p	CLIP-seq
MIRT1078178	hsa-miR-302a	CLIP-seq
MIRT1078179	hsa-miR-302b	CLIP-seq
MIRT1078180	hsa-miR-302c	CLIP-seq
MIRT1078181	hsa-miR-302d	CLIP-seq
MIRT1078182	hsa-miR-302e	CLIP-seq
MIRT1078193	hsa-miR-3676	CLIP-seq
MIRT1078194	hsa-miR-3678-3p	CLIP-seq
MIRT1078195	hsa-miR-3692	CLIP-seq
MIRT1078196	hsa-miR-372	CLIP-seq
MIRT1078197	hsa-miR-373	CLIP-seq
MIRT1078208	hsa-miR-519a	CLIP-seq
MIRT1078209	hsa-miR-519b-3p	CLIP-seq
MIRT1078210	hsa-miR-519c-3p	CLIP-seq
MIRT1078211	hsa-miR-520a-3p	CLIP-seq
MIRT1078212	hsa-miR-520b	CLIP-seq
MIRT1078213	hsa-miR-520c-3p	CLIP-seq
MIRT1078214	hsa-miR-520d-3p	CLIP-seq
MIRT1078215	hsa-miR-520e	CLIP-seq
MIRT1078170	hsa-miR-101	CLIP-seq
MIRT2019480	hsa-miR-1207-5p	CLIP-seq
MIRT1078171	hsa-miR-1236	CLIP-seq
MIRT1078174	hsa-miR-1908	CLIP-seq
MIRT2019481	hsa-miR-1909	CLIP-seq
MIRT1078175	hsa-miR-1911	CLIP-seq
MIRT1078177	hsa-miR-2467-3p	CLIP-seq
MIRT1078183	hsa-miR-30a	CLIP-seq
MIRT1078184	hsa-miR-30b	CLIP-seq
MIRT1078185	hsa-miR-30c	CLIP-seq
MIRT1078186	hsa-miR-30d	CLIP-seq
MIRT1078187	hsa-miR-30e	CLIP-seq
MIRT1078188	hsa-miR-3127-3p	CLIP-seq
MIRT2019482	hsa-miR-3180	CLIP-seq
MIRT2019483	hsa-miR-3180-3p	CLIP-seq
MIRT1078190	hsa-miR-3190	CLIP-seq
MIRT2019484	hsa-miR-3196	CLIP-seq
MIRT1078191	hsa-miR-339-5p	CLIP-seq
MIRT1078192	hsa-miR-3616-3p	CLIP-seq
MIRT1078193	hsa-miR-3676	CLIP-seq
MIRT1078194	hsa-miR-3678-3p	CLIP-seq
MIRT1078195	hsa-miR-3692	CLIP-seq
MIRT1078198	hsa-miR-3937	CLIP-seq
MIRT1078199	hsa-miR-4267	CLIP-seq
MIRT1078200	hsa-miR-4313	CLIP-seq
MIRT2019485	hsa-miR-4436b-3p	CLIP-seq
MIRT1078201	hsa-miR-4467	CLIP-seq
MIRT2019486	hsa-miR-4488	CLIP-seq
MIRT1078202	hsa-miR-4640-5p	CLIP-seq
MIRT2019487	hsa-miR-4669	CLIP-seq
MIRT2019488	hsa-miR-4697-5p	CLIP-seq
MIRT2019489	hsa-miR-4719	CLIP-seq
MIRT1078204	hsa-miR-4726-5p	CLIP-seq
MIRT1078205	hsa-miR-4728-5p	CLIP-seq
MIRT2019490	hsa-miR-4731-3p	CLIP-seq
MIRT1078206	hsa-miR-4743	CLIP-seq
MIRT2019491	hsa-miR-4763-3p	CLIP-seq
MIRT1078207	hsa-miR-4787-5p	CLIP-seq
MIRT2019492	hsa-miR-4801	CLIP-seq
MIRT1078216	hsa-miR-615-5p	CLIP-seq
MIRT2019493	hsa-miR-656	CLIP-seq
MIRT1078217	hsa-miR-663	CLIP-seq
MIRT1078218	hsa-miR-744	CLIP-seq
MIRT1078170	hsa-miR-101	CLIP-seq
MIRT1078171	hsa-miR-1236	CLIP-seq
MIRT2251315	hsa-miR-1280	CLIP-seq
MIRT1078174	hsa-miR-1908	CLIP-seq
MIRT1078175	hsa-miR-1911	CLIP-seq
MIRT1078176	hsa-miR-1915	CLIP-seq
MIRT1078178	hsa-miR-302a	CLIP-seq
MIRT1078179	hsa-miR-302b	CLIP-seq
MIRT1078180	hsa-miR-302c	CLIP-seq
MIRT1078181	hsa-miR-302d	CLIP-seq
MIRT1078182	hsa-miR-302e	CLIP-seq
MIRT1078183	hsa-miR-30a	CLIP-seq
MIRT1078184	hsa-miR-30b	CLIP-seq
MIRT1078185	hsa-miR-30c	CLIP-seq
MIRT1078186	hsa-miR-30d	CLIP-seq
MIRT1078187	hsa-miR-30e	CLIP-seq
MIRT1078189	hsa-miR-3179	CLIP-seq
MIRT2251316	hsa-miR-3180-5p	CLIP-seq
MIRT1078190	hsa-miR-3190	CLIP-seq
MIRT2251317	hsa-miR-338-3p	CLIP-seq
MIRT1078191	hsa-miR-339-5p	CLIP-seq
MIRT2251318	hsa-miR-3613-3p	CLIP-seq
MIRT1078193	hsa-miR-3676	CLIP-seq
MIRT2251319	hsa-miR-3689a-3p	CLIP-seq
MIRT2251320	hsa-miR-3689c	CLIP-seq
MIRT2251321	hsa-miR-3690	CLIP-seq
MIRT1078195	hsa-miR-3692	CLIP-seq
MIRT1078196	hsa-miR-372	CLIP-seq
MIRT1078197	hsa-miR-373	CLIP-seq
MIRT1078198	hsa-miR-3937	CLIP-seq
MIRT1078199	hsa-miR-4267	CLIP-seq
MIRT2251322	hsa-miR-4272	CLIP-seq
MIRT2251323	hsa-miR-4292	CLIP-seq
MIRT2251324	hsa-miR-4308	CLIP-seq
MIRT1078200	hsa-miR-4313	CLIP-seq
MIRT1078201	hsa-miR-4467	CLIP-seq
MIRT2251325	hsa-miR-4517	CLIP-seq
MIRT2251326	hsa-miR-4530	CLIP-seq
MIRT1078202	hsa-miR-4640-5p	CLIP-seq
MIRT1078203	hsa-miR-4726-3p	CLIP-seq
MIRT1078204	hsa-miR-4726-5p	CLIP-seq
MIRT1078205	hsa-miR-4728-5p	CLIP-seq
MIRT2251327	hsa-miR-4796-3p	CLIP-seq
MIRT1078208	hsa-miR-519a	CLIP-seq
MIRT1078209	hsa-miR-519b-3p	CLIP-seq
MIRT1078210	hsa-miR-519c-3p	CLIP-seq
MIRT1078211	hsa-miR-520a-3p	CLIP-seq
MIRT1078212	hsa-miR-520b	CLIP-seq
MIRT1078213	hsa-miR-520c-3p	CLIP-seq
MIRT1078214	hsa-miR-520d-3p	CLIP-seq
MIRT1078215	hsa-miR-520e	CLIP-seq
MIRT2251328	hsa-miR-548t	CLIP-seq
MIRT2019493	hsa-miR-656	CLIP-seq
MIRT1078217	hsa-miR-663	CLIP-seq
MIRT2251329	hsa-miR-711	CLIP-seq
MIRT1078218	hsa-miR-744	CLIP-seq
MIRT2251330	hsa-miR-922	CLIP-seq

Transcription factors

Show/Hide all(7)

Transcription factor	Regulation	Reference
ESR1	Activation	11477071
MYC	Repression	18838534
NFKB1	Activation	17018379
RBMX	Repression	16707624
RELA	Activation	17018379
STAT3	Activation	17204573
WT1	Unknown	17430890

Show/Hide all(48)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000785	Component	Chromatin	TAS	2513129
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IEA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0001570	Process	Vasculogenesis	IEA
GO:0001649	Process	Osteoblast differentiation	IEA
GO:0001701	Process	In utero embryonic development	IEA
GO:0001829	Process	Trophectodermal cell differentiation	IEA
GO:0002158	Process	Osteoclast proliferation	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003677	Function	DNA binding	TAS	10764760
GO:0003690	Function	Double-stranded DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0005515	Function	Protein binding	IPI	16189514, 16511568, 18671972, 18692475, 19064921, 19321746, 20102225, 20195357, 20211142, 21988832, 23661758, 24029232, 25416956, 25609649, 26496610, 28514442, 29997244, 30833792, 31467278, 32296183, 32814053, 33961781, 35140242, 35271311, 37398436
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	20102225, 23661758
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005667	Component	Transcription regulator complex	IBA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	NAS	20102225, 23661758
GO:0006357	Process	Regulation of transcription by RNA polymerase II	TAS	2513129
GO:0030154	Process	Cell differentiation	IEA
GO:0030316	Process	Osteoclast differentiation	IEA
GO:0033687	Process	Osteoblast proliferation	IEA
GO:0035976	Component	Transcription factor AP-1 complex	IDA	10508860
GO:0035976	Component	Transcription factor AP-1 complex	IEA
GO:0042127	Process	Regulation of cell population proliferation	IBA
GO:0045597	Process	Positive regulation of cell differentiation	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	10508860
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0046697	Process	Decidualization	IEA
GO:0048545	Process	Response to steroid hormone	IBA
GO:0051726	Process	Regulation of cell cycle	IBA
GO:0051726	Process	Regulation of cell cycle	IEA
GO:0060136	Process	Embryonic process involved in female pregnancy	IEA
GO:0060716	Process	Labyrinthine layer blood vessel development	IEA
GO:0071277	Process	Cellular response to calcium ion	IEA
GO:0090575	Component	RNA polymerase II transcription regulator complex	IPI	20102225, 23661758
GO:0140467	Process	Integrated stress response signaling	NAS	28566324
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:2000319	Process	Regulation of T-helper 17 cell differentiation	NAS	29234109

MIM	HGNC	e!Ensembl
165161	6205	ENSG00000171223

Protein

UniProt ID

P17275

Protein name

Transcription factor JunB (Transcription factor AP-1 subunit JunB)

Protein function

Transcription factor involved in regulating gene activity following the primary growth factor response. Binds to the DNA sequence 5'-TGA[GC]TCA-3'. Heterodimerizes with proteins of the FOS family to form an AP-1 transcription complex, thereby en

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03957	Jun	5 → 257	Jun-like transcription factor	Family
PF00170	bZIP_1	266 → 329	bZIP transcription factor	Coiled-coil

Sequence

MCTKMEQPFYHDDSYTATGYGRAPGGLSLHDYKLLKPSLAVNLADPYRSLKAPGARGPGP
EGGGGGSYFSGQGSDTGASLKLASSELERLIVPNSNGVITTTPTPPGQYFYPRGGGSGGG
AGGAGGGVTEEQEGFADGFVKALDDLHKMNHVTPPNVSLGATGGPPAGPGGVYAGPEPPP
VYTNLSSYSPASASSGGAGAAVGTGSSYPTTTISYLPHAPPFAGGHPAQLGLGRGASTFK
EEPQTVPEARSRDATPPVSPINMEDQERIKVERKRLRNRLAATKCRKRKLERIARLEDKV
KTLKAENAGLSSTAGLLREQVAQLKQKVMTHVSNGCQLLLGVKGHAF

Sequence length

347

Interactions

View interactions

	KEGG		Reactome
	Osteoclast differentiation TNF signaling pathway Growth hormone synthesis, secretion and action		SMAD2/SMAD3:SMAD4 heterotrimer regulates transcription Interleukin-4 and Interleukin-13 signaling NGF-stimulated transcription

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
T-Cell Lymphoma/Leukemia	Adult T-cell leukemia/lymphoma	Here we report genome-wide CRISPR-Cas9 screening of ATLL models, which identified CDK6, CCND2, BATF3, JUNB, STAT3, and IL10RB as genes that are essential for the proliferation and/or survival of ATLL cells.	34818414	CBGDA

Show/Hide Text Mining Associations (172)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Acne Vulgaris	Stimulate	15920154
Adenocarcinoma	Associate	28859074
Adenomyosis	Inhibit	32933042
Anemia Sickle Cell	Associate	21175428
Aortic Aneurysm Abdominal	Stimulate	20488324
Aortic Valve Stenosis	Associate	39766890
Arthritis	Associate	17626252
Arthritis Rheumatoid	Associate	15142264, 16646028, 39394168
Asthma	Associate	34004182, 34591794
Atherosclerosis	Associate	15210574
Autism Spectrum Disorder	Associate	36862688
Autoimmune Diseases	Associate	29561802
Behcet Syndrome	Associate	37848613
Blood Platelet Disorders	Associate	3487353
Brain Neoplasms	Associate	26722465
Breast Neoplasms	Associate	10501656, 10766836, 14704150, 15044447, 16984733, 17407600, 1906001, 20626868, 21310944, 21393445, 24073962, 31370904, 31964465, 33760219, 34463254, 35726195 View all (1 more)
Carcinogenesis	Associate	10788437, 18391017, 19758438, 40598282
Carcinoma Hepatocellular	Associate	15991283, 20930381, 21862593, 23485556, 26057631, 30250040, 32977498
Carcinoma in Situ	Stimulate	37704624
Carcinoma Ovarian Epithelial	Associate	12432283, 26098087
Carcinoma Renal Cell	Associate	34445576, 38114996, 38197755
Carcinoma Small Cell	Associate	33355532
Cardiomyopathies	Associate	24222245
Cardiovascular Diseases	Associate	17626252
Cell Transformation Neoplastic	Stimulate	18219112
Cerebral Infarction	Associate	28834871
Chemical and Drug Induced Liver Injury	Associate	29106686
Cholangiocarcinoma	Associate	34942351
Chondrosarcoma	Associate	31809267
Churg Strauss Syndrome	Associate	20729468
Cocaine Related Disorders	Associate	28710498
Colitis Ulcerative	Stimulate	35275975
Colonic Neoplasms	Associate	10744679
Colorectal Neoplasms	Associate	26077911, 26491668, 27735944, 31558874, 33859619, 36896461, 37814323
Colorectal Neoplasms	Stimulate	37530327
Coronary Disease	Associate	26045738, 32957369
Cystic Fibrosis	Associate	18815075
Dermatitis Atopic	Associate	11121152
Diabetes Mellitus	Associate	12388107, 36978091, 37713834
Diabetic Foot	Associate	35909542
Down Syndrome	Associate	16100769, 29642018, 38066591
Drug Hypersensitivity	Associate	31653690
Drug Related Side Effects and Adverse Reactions	Inhibit	20132737
Drug Related Side Effects and Adverse Reactions	Associate	21326808
Endometrial Neoplasms	Associate	11570575
Endometriosis	Associate	35616875, 39411815
Ependymoma	Associate	35803925
Epidermodysplasia Verruciformis	Associate	1316464
Epstein Barr Virus Infections	Associate	21792887
Erythrokeratodermia Variabilis 3	Associate	31630791
Esophageal Neoplasms	Associate	19534809, 19558549
Esophageal Neoplasms	Stimulate	19758438
Esophageal Squamous Cell Carcinoma	Associate	19758438, 24107296, 30227324
Fatty Liver	Associate	30250040
Fibrosis	Associate	30250040
Fibrous Dysplasia of Bone	Associate	39766890
Glioblastoma	Associate	21088499, 34399888, 35538663
Glomerulonephritis IGA	Associate	31392215, 38278877
Glomerulonephritis Membranous	Inhibit	20132737
Glycogen Storage Disease Type V	Inhibit	27479139
Glycosuria Renal	Associate	36978091
Head and Neck Neoplasms	Associate	21480395
Heart Block	Associate	22665440
Heart Diseases	Associate	37994565
Hematologic Neoplasms	Associate	34294125
Hepatitis B	Associate	23485556
Hereditary leiomyomatosis and renal cell cancer	Associate	12875982, 15920551, 17965727, 18641027
Hodgkin Disease	Associate	12145210, 17965727, 22107829, 27538486, 30213827, 30375407
Hodgkin Disease	Stimulate	15920551
Hypertension Pulmonary	Associate	12909593
Hypertrophy	Associate	35406794
Hypoxia	Associate	11278891, 20626868, 24275182, 33599733
Hypoxia	Stimulate	12909593
Hypoxia Brain	Stimulate	9500201
IgA Vasculitis	Associate	15142264
Immune System Diseases	Associate	29561802, 31653690
Infarction	Stimulate	37994565
Infections	Stimulate	26942879
Infections	Associate	31572371, 31740529, 9094704
Inflammation	Associate	12874341, 15210574, 15920154, 16002723, 16247412, 16489115, 17043106, 18285351, 20181789, 20406432, 20488324, 20824100, 21454713, 24066944, 26045738 View all (19 more)
Inflammation	Inhibit	23163821, 29763932
Inflammatory Bowel Diseases	Associate	31653690, 35275975
Insulin Resistance	Associate	20181789
Ischemic Stroke	Stimulate	30588195
Leiomyoma	Associate	32094355
Leukemia	Associate	29561802
Leukemia Biphenotypic Acute	Associate	25193702
Leukemia Lymphocytic Chronic B Cell	Associate	26780610
Leukemia Lymphoma Adult T Cell	Associate	35675522
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	12506033
Leukemia Myelogenous Chronic BCR ABL Positive	Inhibit	12506033
Leukemia Myeloid	Associate	1373742
Leukemia Myeloid Acute	Associate	19279403, 37535066
Leukemia Plasma Cell	Associate	14717776
Liver Failure	Associate	30250040
Liver Neoplasms	Associate	22919248
Lung Neoplasms	Associate	35134341, 35910766, 36183833
Lupus Erythematosus Systemic	Associate	31263277
Lupus Erythematosus Systemic	Inhibit	7882553
Lupus Nephritis	Associate	18285351
Lymphedema	Associate	12393503
Lymphoma	Associate	15920551, 17690253, 20132737, 29561802, 30375407
Lymphoma B Cell	Associate	12393503, 30213827
Lymphoma B Cell Marginal Zone	Associate	15507668
Lymphoma Large B Cell Diffuse	Associate	15920551, 22980495, 31935288
Lymphoma Large B Cell Diffuse	Stimulate	26747248
Lymphoma Large Cell Anaplastic	Associate	12393503, 15920551, 17690253, 17965727, 21326808, 22107829, 23716562, 25145835, 25987255, 27705804
Lymphoma Primary Cutaneous Anaplastic Large Cell	Associate	15920551
Lymphoma Primary Effusion	Associate	21792887
Lymphoma T Cell Cutaneous	Associate	12393503, 20559121
Lymphoma T Cell Peripheral	Stimulate	23716562
Lymphomatoid Papulosis	Associate	15920551
Malformations of Cortical Development Group I	Associate	16098468
Melanoma	Associate	14717848, 1614870, 16373707, 1712822, 19269971, 34343000, 36341538
Mesothelioma	Associate	18795165
Multiple Sclerosis	Associate	31653690
Muscular Atrophy	Associate	39354574
Myasthenia Gravis	Associate	29807388
Mycosis Fungoides	Stimulate	12393503
Myeloproliferative Disorders	Inhibit	12506033
Myoclonic Epilepsies Progressive	Associate	30375407
Nasopharyngeal Carcinoma	Associate	20051109, 29017171, 31691433, 37479694
Neoplasm Invasiveness	Associate	32856873
Neoplasm Metastasis	Associate	10788437, 15702969, 21734448, 29934435
Neoplasms	Associate	10408700, 11570575, 15702969, 15920551, 16002723, 17510387, 17822788, 21668942, 22065079, 22107829, 24073962, 26639992, 27705804, 28427184, 28482915 View all (15 more)
Neoplasms	Inhibit	12080089, 18391017, 19236911, 23163821
Neoplasms	Stimulate	24597571
Neoplasms Glandular and Epithelial	Associate	16489115
Nephritis Interstitial	Associate	18285351
Neurodegenerative Diseases	Associate	20488324
Neuroinflammatory Diseases	Associate	32210464, 36862688
Non alcoholic Fatty Liver Disease	Associate	19165171
Obesity	Associate	19165171
Oropharyngeal Neoplasms	Associate	25271301
Osteoporosis	Associate	36311708
Ovarian Neoplasms	Inhibit	12080089
Ovarian Neoplasms	Associate	26261528, 30287916
Pancreatic Neoplasms	Associate	22109562, 32513126
Parkinson Disease	Associate	35250991
Personality Disorders	Associate	34399888
Pheochromocytoma	Associate	16098468
Pneumonia	Associate	18815075, 23163821, 27010141
Polycystic Ovary Syndrome	Associate	33228780, 34632798
Popliteal Artery Aneurysm	Stimulate	20488324
Precancerous Conditions	Stimulate	37530327
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	18322253, 28603286
Prostatic Neoplasms	Associate	10408700, 22496589, 22665440, 23803661, 24191894, 28005952, 36321189
Prostatic Neoplasms Castration Resistant	Associate	21559022
Prostatitis	Stimulate	36321189
Psoriasis	Associate	35277199
Renal Insufficiency Chronic	Associate	31257514
Respiratory Insufficiency	Stimulate	18288638
Rosacea	Associate	34290700
Rotavirus Infections	Associate	12093168
Scleroderma Systemic	Associate	30312535
Sezary Syndrome	Stimulate	12393503
Skin Diseases	Associate	26633653
Sleep Initiation and Maintenance Disorders	Inhibit	25748580
Sleep Wake Disorders	Associate	32360438
Squamous Cell Carcinoma of Head and Neck	Associate	17217620, 17498291, 20949447, 24205072, 35732647
Status Asthmaticus	Associate	12452838
Stomach Neoplasms	Associate	10912998, 18032479, 26942879, 37337631
Substance Related Disorders	Inhibit	34343000
Thyroid Cancer Papillary	Associate	30704487, 32856873
Thyroid Neoplasms	Associate	30704487
Tooth Loss	Inhibit	20132737
Urinary Bladder Neoplasms	Associate	23271730, 25050631
Uterine Cervical Neoplasms	Associate	21937452
Uveal melanoma	Associate	29899166
Vaccinia	Associate	39940969
von Hippel Lindau Disease	Associate	20560986
Waldenstrom Macroglobulinemia	Associate	31935288

JUNB (JunB proto-oncogene, AP-1 transcription factor subunit)