Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
37
Gene name Gene Name - the full gene name approved by the HGNC.
Acyl-CoA dehydrogenase very long chain
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ACADVL
Synonyms (NCBI Gene) Gene synonyms aliases
ACAD6, LCACD, VLCAD
Chromosome Chromosome number
17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
17p13.1
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is targeted to the inner mitochondrial membrane where it catalyzes the first step of the mitochondrial fatty acid beta-oxidation pathway. This acyl-Coenzyme A dehydrogenase is specific to long-chain and very-long-chain fat
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs113994167 T>C Pathogenic Coding sequence variant, non coding transcript variant, missense variant
rs113994168 C>T Pathogenic, pathogenic-likely-pathogenic Coding sequence variant, non coding transcript variant, missense variant
rs149467828 C>A,T Likely-pathogenic Missense variant, non coding transcript variant, stop gained, coding sequence variant
rs150149784 G>C,T Conflicting-interpretations-of-pathogenicity Missense variant, non coding transcript variant, coding sequence variant
rs200573371 G>A Pathogenic-likely-pathogenic, uncertain-significance Non coding transcript variant, coding sequence variant, missense variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT022569 hsa-miR-124-3p Microarray 18668037
MIRT023705 hsa-miR-1-3p Proteomics 18668040
MIRT039914 hsa-miR-615-3p CLASH 23622248
MIRT038930 hsa-miR-31-3p CLASH 23622248
MIRT761647 hsa-miR-128 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000062 Function Fatty-acyl-CoA binding IBA
GO:0001659 Process Temperature homeostasis IEA
GO:0001659 Process Temperature homeostasis ISS
GO:0003995 Function Acyl-CoA dehydrogenase activity IEA
GO:0003995 Function Acyl-CoA dehydrogenase activity IMP 9461620, 9599005
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
609575 92 ENSG00000072778
Protein
UniProt ID P49748
Protein name Very long-chain specific acyl-CoA dehydrogenase, mitochondrial (VLCAD) (EC 1.3.8.9)
Protein function Very long-chain specific acyl-CoA dehydrogenase is one of the acyl-CoA dehydrogenases that catalyze the first step of mitochondrial fatty acid beta-oxidation, an aerobic process breaking down fatty acids into acetyl-CoA and allowing the producti
PDB 2UXW , 3B96 , 7S7G
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02771 Acyl-CoA_dh_N 95 209 Acyl-CoA dehydrogenase, N-terminal domain Domain
PF02770 Acyl-CoA_dh_M 213 315 Acyl-CoA dehydrogenase, middle domain Domain
PF00441 Acyl-CoA_dh_1 327 476 Acyl-CoA dehydrogenase, C-terminal domain Domain
Tissue specificity TISSUE SPECIFICITY: Predominantly expressed in heart and skeletal muscle (at protein level). Also detected in kidney and liver (at protein level). {ECO:0000269|PubMed:8845838}.
Sequence
MQAARMAASLGRQLLRLGGGSSRLTALLGQPRPGPARRPYAGGAAQLALDKSDSHPSDAL
TRKKPAKAESKSFAVGMFKGQLTTDQVFPYPSVLNEEQTQFLKELVEPVSRFFEEVNDPA
KNDALEMVEETTWQGLKELGAFGLQVPSELGGVGLCNTQYARLVEIVGMHDLGVGITLGA
HQSIGFKGILLFGTKAQKEKYLPKLASGE
TVAAFCLTEPSSGSDAASIRTSAVPSPCGKY
YTLNGSKLWISNGGLADIFTVFAKTPVTDPATGAVKEKITAFVVERGFGGITHGPPEKKM
GIKASNTAEVFFDGV
RVPSENVLGEVGSGFKVAMHILNNGRFGMAAALAGTMRGIIAKAV
DHATNRTQFGEKIHNFGLIQEKLARMVMLQYVTESMAYMVSANMDQGATDFQIEAAISKI
FGSEAAWKVTDECIQIMGGMGFMKEPGVERVLRDLRIFRIFEGTNDILRLFVALQG
CMDK
GKELSGLGSALKNPFGNAGLLLGEAGKQLRRRAGLGSGLSLSGLVHPELSRSGELAVRAL
EQFATVVEAKLIKHKKGIVNEQFLLQRLADGAIDLYAMVVVLSRASRSLSEGHPTAQHEK
MLCDTWCIEAAARIREGMAALQSDPWQQELYRNFKSISKALVERGGVVTSNPLGF
Sequence length 655
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Fatty acid degradation
Metabolic pathways
Fatty acid metabolism
Alcoholic liver disease
  XBP1(S) activates chaperone genes
Beta oxidation of palmitoyl-CoA to myristoyl-CoA
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Acyl CoA Dehydrogenase Deficiency very long chain acyl-coa dehydrogenase deficiency rs387906251, rs1555528635, rs1057517386, rs112406105, rs1597526782, rs762619071, rs398123083, rs1555528508, rs1555527495, rs1057516979, rs1555527907, rs1057516686, rs786204738, rs1597520263, rs1555528386
View all (140 more)
N/A
cardiac arrhythmia Cardiac arrhythmia rs1057516843 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Cardiomyopathy Primary dilated cardiomyopathy N/A N/A ClinVar
Hypertrophic Cardiomyopathy Primary familial hypertrophic cardiomyopathy N/A N/A ClinVar
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Carcinoma Hepatocellular Associate 37957550
Cardiomyopathies Associate 32518924, 7479827
Cardiomyopathy Dilated Associate 30840296
Cardiomyopathy Hypertrophic Associate 29768383, 37498360
Chanarin Dorfman Syndrome Associate 36207828, 40225143
Congenital Abnormalities Associate 29459657
Death Sudden Associate 32101375, 7479827
familial dilated cardiomyopathy Associate 30840296
Fibrosis Associate 36894992
Heart Arrest Associate 7479827