ITGB7 (integrin subunit beta 7)

Gene
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
3695
Gene name Gene Name - the full gene name approved by the HGNC.
Integrin subunit beta 7
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ITGB7
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
12q13.13
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a protein that is a member of the integrin superfamily. Members of this family are adhesion receptors that function in signaling from the extracellular matrix to the cell. Integrins are heterodimeric integral membrane proteins composed o
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(15)
miRTarBase ID miRNA Experiments Reference
MIRT1074228 hsa-miR-1262 CLIP-seq
MIRT1074229 hsa-miR-3646 CLIP-seq
MIRT1074230 hsa-miR-3647-3p CLIP-seq
MIRT1074231 hsa-miR-3662 CLIP-seq
MIRT1074232 hsa-miR-4455 CLIP-seq
Transcription factors
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(1)
Transcription factor Regulation Reference
MAF Activation 17490615
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(32)
GO ID Ontology Definition Evidence Reference
GO:0001618 Function Virus receptor activity IEA
GO:0003366 Process Cell-matrix adhesion involved in ameboidal cell migration IMP 23986478
GO:0005178 Function Integrin binding IBA 21873635
GO:0005515 Function Protein binding IPI 1542691, 14681217, 17690686, 19828450, 21524097, 22232704
GO:0005886 Component Plasma membrane TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
147559 6162 ENSG00000139626
Protein
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID P26010
Protein name Integrin beta-7 (Gut homing receptor beta subunit)
Protein function Integrin ITGA4/ITGB7 (alpha-4/beta-7) (Peyer patches-specific homing receptor LPAM-1) is an adhesion molecule that mediates lymphocyte migration and homing to gut-associated lymphoid tissue (GALT) (Probable). Integrin ITGA4/ITGB7 interacts with
PDB 2BRQ , 3V4P , 3V4V , 8ZJF
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF17205 PSI_integrin 43 → 92 Integrin plexin domain Domain
PF00362 Integrin_beta 147 → 393 Integrin beta chain VWA domain Domain
PF07974 EGF_2 605 → 635 EGF-like domain Domain
PF08725 Integrin_b_cyt 747 → 791 Integrin beta cytoplasmic domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in a variety of leukocyte lines.
Sequence 
MVALPMVLVLLLVLSRGESELDAKIPSTGDATEWRNPHLSMLGSCQPAPSCQKCILSHPS
CAWCKQLNFTASGEAEARRCARREELLARGCPLEELEEPRGQQEVLQDQPLSQGARGEGA
TQLAPQRVRVTLRPGEPQQLQVRFLRAEGYPVDLYYLMDLSYSMKDDLERVRQLGHALLV
RLQEVTHSVRIGFGSFVDKTVLPFVSTVPSKLRHPCPTRLERCQSPFSFHHVLSLTGDAQ
AFEREVGRQSVSGNLDSPEGGFDAILQAALCQEQIGWRNVSRLLVFTSDDTFHTAGDGKL
GGIFMPSDGHCHLDSNGLYSRSTEFDYPSVGQVAQALSAANIQPIFAVTSAALPVYQELS
KLIPKSAVGELSEDSSNVVQLIMDAYNSLSSTVTLEHSSLPPGVHISYESQCEGPEKREG
KAEDRGQCNHVRINQTVTFWVSLQATHCLPEPHLLRLRALGFSEELIVELHTLCDCNCSD
TQPQAPHCSDGQGHLQCGVCSCAPGRLGRLCECSVAELSSPDLESGCRAPNGTGPLCSGK
GHCQCGRCSCSGQSSGHLCECDDASCERHEGILCGGFGRCQCGVCHCHANRTGRACECSG
DMDSCISPEGGLCSGHGRCKCNRCQCLDGYYGALCDQCPGCKTPCERHRDCAECGAFRTG
PLATNCSTACAHTNVTLALAPILDDGWCKERTLDNQLFFFLVEDDARGTVVLRVRPQEKG
ADHTQAIVLGCVGGIVAVGLGLVLAYRLSVEIYDRREYSRFEKEQQQLNWKQDSNPLYKS
AITTTINPRFQEADSPTL
Sequence length 798
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Cell adhesion molecules
Intestinal immune network for IgA production
Regulation of actin cytoskeleton
Cytoskeleton in muscle cells
Human papillomavirus infection
Transcriptional misregulation in cancer
Hypertrophic cardiomyopathy
Arrhythmogenic right ventricular cardiomyopathy
Dilated cardiomyopathy 		  Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
Integrin cell surface interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Prostate cancer Prostate carcinoma rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582 27515689
Show/Hide Text Mining Associations (19)
Associations from Text Mining
Disease Name Relationship Type References
Arthritis Rheumatoid Associate 32365786
Carcinoma Hepatocellular Associate 12174369, 12679910, 35027829, 37603520
Carotid Stenosis Associate 37644056
Chromosome 12 12p trisomy Stimulate 24829201
COVID 19 Associate 33413422
Gastrointestinal Diseases Associate 33048222
Glioma Associate 37096960
HIV Infections Associate 34500304
Leukemia Associate 36613907
Leukemia Lymphocytic Chronic B Cell Associate 24829201