Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	3690
Gene name Gene Name - the full gene name approved by the HGNC.	Integrin subunit beta 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	ITGB3
Synonyms (NCBI Gene) Gene synonyms aliases	BDPLT16, BDPLT2, BDPLT24, CD61, FMAIT1, GP3A, GPIIIa, GT, GT2
Disease Acronyms (UniProt) Disease acronyms from UniProt database	BDPLT16, BDPLT24, GT2
Chromosome Chromosome number	17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	17q21.32
Summary Summary of gene provided in NCBI Entrez Gene.	The ITGB3 protein product is the integrin beta chain beta 3. Integrins are integral cell-surface proteins composed of an alpha chain and a beta chain. A given chain may combine with multiple partners resulting in different integrins. Integrin beta 3 is fo

Show/Hide all(23)

SNP ID	Visualize variation	Clinical significance	Consequence
rs5918	T>C	Risk-factor, benign, likely-benign	Coding sequence variant, missense variant
rs79560904	G>A	Pathogenic	Missense variant, coding sequence variant
rs79775494	A>T	Pathogenic	Missense variant, coding sequence variant
rs121918444	G>A	Pathogenic	Coding sequence variant, missense variant
rs121918445	G>A,T	Pathogenic	Coding sequence variant, missense variant
rs121918446	C>T	Pathogenic	Coding sequence variant, missense variant
rs121918449	G>A	Pathogenic	Coding sequence variant, missense variant
rs121918451	G>T	Pathogenic	Coding sequence variant, stop gained
rs121918452	T>G	Pathogenic	Coding sequence variant, missense variant
rs398122373	G>C	Pathogenic	Splice donor variant
rs749261962	A>G	Likely-pathogenic	Splice acceptor variant
rs781062792	C>T	Likely-pathogenic	Missense variant, coding sequence variant
rs958609406	C>T	Likely-pathogenic	Missense variant, coding sequence variant
rs1057518837	C>T	Likely-pathogenic	Coding sequence variant, stop gained
rs1057518838	A>G	Likely-pathogenic	Coding sequence variant, missense variant
rs1199275720	G>A,C	Likely-pathogenic	Coding sequence variant, missense variant
rs1302506624	G>-,GG	Likely-pathogenic	Coding sequence variant, frameshift variant
rs1386425657	->A	Pathogenic	Frameshift variant, coding sequence variant
rs1567764064	G>-	Likely-pathogenic	Frameshift variant, coding sequence variant
rs1598690937	G>C	Likely-pathogenic	Missense variant, coding sequence variant
rs1598690979	A>G	Likely-pathogenic	Missense variant, coding sequence variant
rs1598694640	A>C	Likely-pathogenic	Missense variant, coding sequence variant
rs1598700249	TTTTATTCCTCCATTTTCCCTACTCCCAGAGGACACTGGCAAGGATGCAGTGAATTGTACCTATAAGAATGAGGATGACTGTGTCGTCAGATTCCAGTACTATGAAGATTCTAGTGGAAAGTCCATCCTGTATGTGGTAGAAGAGCCAGGTGAGTGAACCCTGACGGCTCCCG>-	Likely-pathogenic	Coding sequence variant, splice acceptor variant, intron variant, splice donor variant

Show/Hide all(287)

miRTarBase ID	miRNA	Experiments	Reference
MIRT000708	hsa-let-7a-5p	qRT-PCR, Luciferase reporter assay, Western blot	18679415
MIRT000708	hsa-let-7a-5p	Luciferase reporter assay	18679415
MIRT005833	hsa-miR-204-5p	Microarray	21282569
MIRT007133	hsa-miR-30c-5p	qRT-PCR	23418453
MIRT022107	hsa-miR-125b-5p	Other	20194440
MIRT048710	hsa-miR-98-5p	CLASH	23622248
MIRT054066	hsa-let-7c-5p	H157	23981581
MIRT054066	hsa-let-7c-5p	H157	23981581
MIRT054066	hsa-let-7c-5p	H157	23981581
MIRT054476	hsa-miR-320a	Luciferase reporter assay, qRT-PCR, Western blot	24443232
MIRT438114	hsa-miR-124-3p	Luciferase reporter assay	23451109
MIRT438114	hsa-miR-124-3p	Luciferase reporter assay	23451109
MIRT677985	hsa-miR-383-3p	HITS-CLIP	23824327
MIRT677984	hsa-miR-5693	HITS-CLIP	23824327
MIRT677983	hsa-miR-6089	HITS-CLIP	23824327
MIRT677982	hsa-miR-34a-5p	HITS-CLIP	23824327
MIRT677981	hsa-miR-34c-5p	HITS-CLIP	23824327
MIRT677980	hsa-miR-449a	HITS-CLIP	23824327
MIRT677979	hsa-miR-449b-5p	HITS-CLIP	23824327
MIRT677978	hsa-miR-4284	HITS-CLIP	23824327
MIRT677977	hsa-miR-24-3p	HITS-CLIP	23824327
MIRT677976	hsa-miR-7106-5p	HITS-CLIP	23824327
MIRT677975	hsa-miR-149-3p	HITS-CLIP	23824327
MIRT677974	hsa-miR-4728-5p	HITS-CLIP	23824327
MIRT677973	hsa-miR-6785-5p	HITS-CLIP	23824327
MIRT677972	hsa-miR-6883-5p	HITS-CLIP	23824327
MIRT677971	hsa-miR-6799-5p	HITS-CLIP	23824327
MIRT677970	hsa-miR-486-3p	HITS-CLIP	23824327
MIRT677969	hsa-miR-7977	HITS-CLIP	23824327
MIRT677968	hsa-miR-30c-1-3p	HITS-CLIP	23824327
MIRT677967	hsa-miR-30c-2-3p	HITS-CLIP	23824327
MIRT677966	hsa-miR-6788-5p	HITS-CLIP	23824327
MIRT677965	hsa-miR-1273h-5p	HITS-CLIP	23824327
MIRT677964	hsa-miR-30b-3p	HITS-CLIP	23824327
MIRT677963	hsa-miR-3689a-3p	HITS-CLIP	23824327
MIRT677962	hsa-miR-3689b-3p	HITS-CLIP	23824327
MIRT677961	hsa-miR-3689c	HITS-CLIP	23824327
MIRT677960	hsa-miR-6779-5p	HITS-CLIP	23824327
MIRT677959	hsa-miR-6780a-5p	HITS-CLIP	23824327
MIRT677958	hsa-miR-450a-1-3p	HITS-CLIP	23824327
MIRT677957	hsa-miR-3122	HITS-CLIP	23824327
MIRT677956	hsa-miR-3913-5p	HITS-CLIP	23824327
MIRT677955	hsa-miR-887-5p	HITS-CLIP	23824327
MIRT677954	hsa-miR-6513-5p	HITS-CLIP	23824327
MIRT731716	hsa-miR-17-3p	Luciferase reporter assay, qRT-PCR, Western blot	27499367
MIRT731716	hsa-miR-17-3p	Luciferase reporter assay, qRT-PCR, Western blot	27499367
MIRT732305	hsa-miR-30a-5p	Luciferase reporter assay, Western blot	27576787
MIRT732305	hsa-miR-30a-5p	Luciferase reporter assay, Western blot	27576787
MIRT054476	hsa-miR-320a	Immunofluorescence, Luciferase reporter assay, Western blot	25924850
MIRT054476	hsa-miR-320a	Immunofluorescence, Luciferase reporter assay, Western blot	25924850
MIRT054476	hsa-miR-320a	Immunofluorescence, Luciferase reporter assay, Western blot	25924850
MIRT054476	hsa-miR-320a	Immunofluorescence, Luciferase reporter assay, Western blot	25924850
MIRT054476	hsa-miR-320a	Immunofluorescence, Luciferase reporter assay, Western blot	25924850
MIRT054476	hsa-miR-320a	Immunofluorescence, Luciferase reporter assay, Western blot	25924850
MIRT054476	hsa-miR-320a	Immunofluorescence, Luciferase reporter assay, Western blot	25924850
MIRT048710	hsa-miR-98-5p	Luciferase reporter assay	26445551
MIRT048710	hsa-miR-98-5p	Luciferase reporter assay	26445551
MIRT048710	hsa-miR-98-5p	Luciferase reporter assay	26445551
MIRT048710	hsa-miR-98-5p	Luciferase reporter assay	26445551
MIRT048710	hsa-miR-98-5p	Luciferase reporter assay	26445551
MIRT048710	hsa-miR-98-5p	Luciferase reporter assay	26445551
MIRT048710	hsa-miR-98-5p	Luciferase reporter assay	26445551
MIRT048710	hsa-miR-98-5p	Luciferase reporter assay	26445551
MIRT048710	hsa-miR-98-5p	Luciferase reporter assay	26445551
MIRT048710	hsa-miR-98-5p	Luciferase reporter assay	26445551
MIRT048710	hsa-miR-98-5p	Luciferase reporter assay, qRT-PCR, Western blot	26445551
MIRT048710	hsa-miR-98-5p	Luciferase reporter assay, qRT-PCR, Western blot	26445551
MIRT048710	hsa-miR-98-5p	Luciferase reporter assay, qRT-PCR, Western blot	26445551
MIRT048710	hsa-miR-98-5p	Luciferase reporter assay, qRT-PCR, Western blot	26445551
MIRT677985	hsa-miR-383-3p	HITS-CLIP	23824327
MIRT677984	hsa-miR-5693	HITS-CLIP	23824327
MIRT677983	hsa-miR-6089	HITS-CLIP	23824327
MIRT677982	hsa-miR-34a-5p	HITS-CLIP	23824327
MIRT677981	hsa-miR-34c-5p	HITS-CLIP	23824327
MIRT677980	hsa-miR-449a	HITS-CLIP	23824327
MIRT677979	hsa-miR-449b-5p	HITS-CLIP	23824327
MIRT677978	hsa-miR-4284	HITS-CLIP	23824327
MIRT677977	hsa-miR-24-3p	HITS-CLIP	23824327
MIRT677976	hsa-miR-7106-5p	HITS-CLIP	23824327
MIRT677975	hsa-miR-149-3p	HITS-CLIP	23824327
MIRT677974	hsa-miR-4728-5p	HITS-CLIP	23824327
MIRT677973	hsa-miR-6785-5p	HITS-CLIP	23824327
MIRT677972	hsa-miR-6883-5p	HITS-CLIP	23824327
MIRT677971	hsa-miR-6799-5p	HITS-CLIP	23824327
MIRT677970	hsa-miR-486-3p	HITS-CLIP	23824327
MIRT677969	hsa-miR-7977	HITS-CLIP	23824327
MIRT677968	hsa-miR-30c-1-3p	HITS-CLIP	23824327
MIRT677967	hsa-miR-30c-2-3p	HITS-CLIP	23824327
MIRT677966	hsa-miR-6788-5p	HITS-CLIP	23824327
MIRT677965	hsa-miR-1273h-5p	HITS-CLIP	23824327
MIRT677964	hsa-miR-30b-3p	HITS-CLIP	23824327
MIRT677963	hsa-miR-3689a-3p	HITS-CLIP	23824327
MIRT677962	hsa-miR-3689b-3p	HITS-CLIP	23824327
MIRT677961	hsa-miR-3689c	HITS-CLIP	23824327
MIRT677960	hsa-miR-6779-5p	HITS-CLIP	23824327
MIRT677959	hsa-miR-6780a-5p	HITS-CLIP	23824327
MIRT677958	hsa-miR-450a-1-3p	HITS-CLIP	23824327
MIRT677957	hsa-miR-3122	HITS-CLIP	23824327
MIRT677956	hsa-miR-3913-5p	HITS-CLIP	23824327
MIRT677955	hsa-miR-887-5p	HITS-CLIP	23824327
MIRT677954	hsa-miR-6513-5p	HITS-CLIP	23824327
MIRT1074106	hsa-miR-1185	CLIP-seq
MIRT1074107	hsa-miR-1225-3p	CLIP-seq
MIRT1074108	hsa-miR-1228	CLIP-seq
MIRT1074109	hsa-miR-124	CLIP-seq
MIRT1074110	hsa-miR-139-5p	CLIP-seq
MIRT1074111	hsa-miR-145	CLIP-seq
MIRT1074112	hsa-miR-22	CLIP-seq
MIRT1074113	hsa-miR-25	CLIP-seq
MIRT1074114	hsa-miR-2681	CLIP-seq
MIRT1074115	hsa-miR-3120-3p	CLIP-seq
MIRT1074116	hsa-miR-3161	CLIP-seq
MIRT1074117	hsa-miR-3163	CLIP-seq
MIRT1074118	hsa-miR-3184	CLIP-seq
MIRT1074119	hsa-miR-3190	CLIP-seq
MIRT1074120	hsa-miR-32	CLIP-seq
MIRT1074121	hsa-miR-3200-5p	CLIP-seq
MIRT1074122	hsa-miR-3605-5p	CLIP-seq
MIRT1074123	hsa-miR-3614-3p	CLIP-seq
MIRT1074124	hsa-miR-363	CLIP-seq
MIRT1074125	hsa-miR-3653	CLIP-seq
MIRT1074126	hsa-miR-3658	CLIP-seq
MIRT1074127	hsa-miR-367	CLIP-seq
MIRT1074128	hsa-miR-3679-5p	CLIP-seq
MIRT1074129	hsa-miR-3911	CLIP-seq
MIRT1074130	hsa-miR-409-3p	CLIP-seq
MIRT1074131	hsa-miR-423-5p	CLIP-seq
MIRT1074132	hsa-miR-4282	CLIP-seq
MIRT1074133	hsa-miR-4318	CLIP-seq
MIRT1074134	hsa-miR-4325	CLIP-seq
MIRT1074135	hsa-miR-4328	CLIP-seq
MIRT1074136	hsa-miR-4421	CLIP-seq
MIRT1074137	hsa-miR-4455	CLIP-seq
MIRT1074138	hsa-miR-4470	CLIP-seq
MIRT1074139	hsa-miR-4519	CLIP-seq
MIRT1074140	hsa-miR-4649-3p	CLIP-seq
MIRT1074141	hsa-miR-4712-3p	CLIP-seq
MIRT1074142	hsa-miR-4732-5p	CLIP-seq
MIRT1074143	hsa-miR-4749-3p	CLIP-seq
MIRT1074144	hsa-miR-490-5p	CLIP-seq
MIRT1074145	hsa-miR-506	CLIP-seq
MIRT1074146	hsa-miR-520a-5p	CLIP-seq
MIRT1074147	hsa-miR-525-5p	CLIP-seq
MIRT1074148	hsa-miR-544	CLIP-seq
MIRT1074149	hsa-miR-548an	CLIP-seq
MIRT1074150	hsa-miR-558	CLIP-seq
MIRT1074151	hsa-miR-663b	CLIP-seq
MIRT1074152	hsa-miR-767-3p	CLIP-seq
MIRT1074153	hsa-miR-92a	CLIP-seq
MIRT1074154	hsa-miR-92b	CLIP-seq
MIRT1074111	hsa-miR-145	CLIP-seq
MIRT2018314	hsa-miR-204	CLIP-seq
MIRT2018315	hsa-miR-211	CLIP-seq
MIRT2018316	hsa-miR-3164	CLIP-seq
MIRT2018317	hsa-miR-3609	CLIP-seq
MIRT2018318	hsa-miR-4327	CLIP-seq
MIRT1074135	hsa-miR-4328	CLIP-seq
MIRT2018319	hsa-miR-4453	CLIP-seq
MIRT2018320	hsa-miR-4538	CLIP-seq
MIRT2018321	hsa-miR-4708-3p	CLIP-seq
MIRT2018322	hsa-miR-4755-5p	CLIP-seq
MIRT2018323	hsa-miR-4780	CLIP-seq
MIRT1074144	hsa-miR-490-5p	CLIP-seq
MIRT1074148	hsa-miR-544	CLIP-seq
MIRT2018324	hsa-miR-548ah	CLIP-seq
MIRT2018325	hsa-miR-617	CLIP-seq
MIRT2018326	hsa-miR-623	CLIP-seq
MIRT1074152	hsa-miR-767-3p	CLIP-seq
MIRT1074108	hsa-miR-1228	CLIP-seq
MIRT2250183	hsa-miR-1236	CLIP-seq
MIRT2250184	hsa-miR-1246	CLIP-seq
MIRT2250185	hsa-miR-3127-5p	CLIP-seq
MIRT2250186	hsa-miR-3173-5p	CLIP-seq
MIRT2250187	hsa-miR-329	CLIP-seq
MIRT2250188	hsa-miR-362-3p	CLIP-seq
MIRT2250189	hsa-miR-3941	CLIP-seq
MIRT2250190	hsa-miR-4320	CLIP-seq
MIRT2250191	hsa-miR-4438	CLIP-seq
MIRT2250192	hsa-miR-4659a-3p	CLIP-seq
MIRT2250193	hsa-miR-4659b-3p	CLIP-seq
MIRT2250194	hsa-miR-4690-3p	CLIP-seq
MIRT2250195	hsa-miR-4753-3p	CLIP-seq
MIRT2250196	hsa-miR-5095	CLIP-seq
MIRT2250197	hsa-miR-603	CLIP-seq
MIRT1074151	hsa-miR-663b	CLIP-seq
MIRT2250198	hsa-miR-938	CLIP-seq
MIRT2250199	hsa-miR-942	CLIP-seq
MIRT1074111	hsa-miR-145	CLIP-seq
MIRT1074135	hsa-miR-4328	CLIP-seq
MIRT1074144	hsa-miR-490-5p	CLIP-seq
MIRT1074148	hsa-miR-544	CLIP-seq
MIRT1074152	hsa-miR-767-3p	CLIP-seq
MIRT2437978	hsa-let-7a	CLIP-seq
MIRT2437979	hsa-let-7b	CLIP-seq
MIRT2437980	hsa-let-7c	CLIP-seq
MIRT2437981	hsa-let-7d	CLIP-seq
MIRT2437982	hsa-let-7e	CLIP-seq
MIRT2437983	hsa-let-7f	CLIP-seq
MIRT2437984	hsa-let-7g	CLIP-seq
MIRT2437985	hsa-let-7i	CLIP-seq
MIRT2437986	hsa-miR-1205	CLIP-seq
MIRT2437987	hsa-miR-1229	CLIP-seq
MIRT2437988	hsa-miR-1286	CLIP-seq
MIRT2437989	hsa-miR-1302	CLIP-seq
MIRT2437990	hsa-miR-202	CLIP-seq
MIRT2437991	hsa-miR-205	CLIP-seq
MIRT2437992	hsa-miR-3173-3p	CLIP-seq
MIRT2437993	hsa-miR-3192	CLIP-seq
MIRT2437994	hsa-miR-320b	CLIP-seq
MIRT2437995	hsa-miR-320c	CLIP-seq
MIRT2437996	hsa-miR-320d	CLIP-seq
MIRT2437997	hsa-miR-320e	CLIP-seq
MIRT2437998	hsa-miR-3612	CLIP-seq
MIRT2437999	hsa-miR-3620	CLIP-seq
MIRT2438000	hsa-miR-3938	CLIP-seq
MIRT2438001	hsa-miR-4298	CLIP-seq
MIRT2438002	hsa-miR-4314	CLIP-seq
MIRT2438003	hsa-miR-4420	CLIP-seq
MIRT2438004	hsa-miR-4428	CLIP-seq
MIRT2438005	hsa-miR-4429	CLIP-seq
MIRT2438006	hsa-miR-4457	CLIP-seq
MIRT2438007	hsa-miR-4458	CLIP-seq
MIRT2438008	hsa-miR-4459	CLIP-seq
MIRT2438009	hsa-miR-4500	CLIP-seq
MIRT2438010	hsa-miR-4521	CLIP-seq
MIRT2438011	hsa-miR-4646-5p	CLIP-seq
MIRT2438012	hsa-miR-4695-5p	CLIP-seq
MIRT2438013	hsa-miR-4722-5p	CLIP-seq
MIRT2438014	hsa-miR-513b	CLIP-seq
MIRT2438015	hsa-miR-650	CLIP-seq
MIRT1074152	hsa-miR-767-3p	CLIP-seq
MIRT2438016	hsa-miR-98	CLIP-seq
MIRT2452003	hsa-miR-4424	CLIP-seq
MIRT2452004	hsa-miR-4499	CLIP-seq
MIRT2452005	hsa-miR-4682	CLIP-seq
MIRT2452006	hsa-miR-548u	CLIP-seq
MIRT2553702	hsa-miR-1234	CLIP-seq
MIRT2250183	hsa-miR-1236	CLIP-seq
MIRT2553703	hsa-miR-1245b-3p	CLIP-seq
MIRT2553704	hsa-miR-125a-5p	CLIP-seq
MIRT2553705	hsa-miR-125b	CLIP-seq
MIRT2553706	hsa-miR-1321	CLIP-seq
MIRT2553707	hsa-miR-150	CLIP-seq
MIRT2553708	hsa-miR-1827	CLIP-seq
MIRT2553709	hsa-miR-186	CLIP-seq
MIRT2437991	hsa-miR-205	CLIP-seq
MIRT2553710	hsa-miR-2467-3p	CLIP-seq
MIRT2553711	hsa-miR-3126-5p	CLIP-seq
MIRT2250185	hsa-miR-3127-5p	CLIP-seq
MIRT2553712	hsa-miR-3136-3p	CLIP-seq
MIRT2553713	hsa-miR-3153	CLIP-seq
MIRT2437992	hsa-miR-3173-3p	CLIP-seq
MIRT2250186	hsa-miR-3173-5p	CLIP-seq
MIRT2437998	hsa-miR-3612	CLIP-seq
MIRT2553714	hsa-miR-3677-5p	CLIP-seq
MIRT2438000	hsa-miR-3938	CLIP-seq
MIRT2553715	hsa-miR-4257	CLIP-seq
MIRT2553716	hsa-miR-4270	CLIP-seq
MIRT2553717	hsa-miR-4319	CLIP-seq
MIRT2553718	hsa-miR-4419a	CLIP-seq
MIRT2553719	hsa-miR-4441	CLIP-seq
MIRT2553720	hsa-miR-4480	CLIP-seq
MIRT2553721	hsa-miR-4481	CLIP-seq
MIRT2553722	hsa-miR-4510	CLIP-seq
MIRT2553723	hsa-miR-4665-3p	CLIP-seq
MIRT2438012	hsa-miR-4695-5p	CLIP-seq
MIRT2553724	hsa-miR-4739	CLIP-seq
MIRT2553725	hsa-miR-4745-5p	CLIP-seq
MIRT2250195	hsa-miR-4753-3p	CLIP-seq
MIRT2553726	hsa-miR-4756-5p	CLIP-seq
MIRT2553727	hsa-miR-4758-5p	CLIP-seq
MIRT2553728	hsa-miR-4793-5p	CLIP-seq
MIRT2553729	hsa-miR-483-3p	CLIP-seq
MIRT2438014	hsa-miR-513b	CLIP-seq
MIRT2553730	hsa-miR-544b	CLIP-seq
MIRT2438015	hsa-miR-650	CLIP-seq
MIRT1074151	hsa-miR-663b	CLIP-seq
MIRT2250198	hsa-miR-938	CLIP-seq
MIRT2250199	hsa-miR-942	CLIP-seq
MIRT2250183	hsa-miR-1236	CLIP-seq
MIRT2250185	hsa-miR-3127-5p	CLIP-seq
MIRT2250186	hsa-miR-3173-5p	CLIP-seq
MIRT2553716	hsa-miR-4270	CLIP-seq
MIRT2553719	hsa-miR-4441	CLIP-seq
MIRT2250195	hsa-miR-4753-3p	CLIP-seq
MIRT2250198	hsa-miR-938	CLIP-seq
MIRT2250199	hsa-miR-942	CLIP-seq

Transcription factors

Show/Hide all(6)

Transcription factor	Regulation	Reference
ETS1	Unknown	11556732
FOSL1	Repression	23319049
HOXA10	Unknown	11875117
HOXD3	Unknown	14610084
JUND	Repression	23319049
SP1	Repression	23319049

Show/Hide all(100)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001618	Function	Virus receptor activity	IEA
GO:0001934	Process	Positive regulation of protein phosphorylation	TAS	19267251
GO:0001938	Process	Positive regulation of endothelial cell proliferation	IMP	10022831
GO:0001968	Function	Fibronectin binding	IBA	21873635
GO:0001968	Function	Fibronectin binding	IMP	24658351
GO:0002020	Function	Protease binding	IDA	22505472
GO:0002576	Process	Platelet degranulation	TAS
GO:0003756	Function	Protein disulfide isomerase activity	IDA	12204115, 15466936
GO:0005161	Function	Platelet-derived growth factor receptor binding	TAS	19267251
GO:0005178	Function	Integrin binding	IBA	21873635
GO:0005178	Function	Integrin binding	IPI	20826760
GO:0005515	Function	Protein binding	IPI	1694173, 2116421, 10822899, 11470407, 11546839, 11884718, 11940607, 12535520, 12682293, 12695522, 12807887, 14593208, 14681217, 15062093, 15299032, 15344881, 15379538, 15466936, 16051604, 16099422, 16115959, 16275649, 16546176, 17218263, 17485491, 18045938, 19141530, 19279667, 19461
GO:0005634	Component	Nucleus	IDA	22027834
GO:0005654	Component	Nucleoplasm	IDA
GO:0005886	Component	Plasma membrane	IDA	15466936, 19141530
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	TAS	2452834
GO:0005911	Component	Cell-cell junction	IDA	19461049
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0005925	Component	Focal adhesion	IBA	21873635
GO:0005925	Component	Focal adhesion	IDA	23023225, 25063885
GO:0007155	Process	Cell adhesion	TAS	2452834, 10429193
GO:0007160	Process	Cell-matrix adhesion	IBA	21873635
GO:0007160	Process	Cell-matrix adhesion	IMP	7525578, 24658351
GO:0007229	Process	Integrin-mediated signaling pathway	HDA	23382103
GO:0007229	Process	Integrin-mediated signaling pathway	IBA	21873635
GO:0007229	Process	Integrin-mediated signaling pathway	TAS	21488147
GO:0007596	Process	Blood coagulation	TAS	1438206
GO:0008305	Component	Integrin complex	IBA	21873635
GO:0008305	Component	Integrin complex	IDA	15215180
GO:0009986	Component	Cell surface	HDA	23382103, 23658023
GO:0009986	Component	Cell surface	IBA	21873635
GO:0009986	Component	Cell surface	IDA	7525578, 19234460, 19933311, 20563599, 22505472, 23023225, 25063885
GO:0010595	Process	Positive regulation of endothelial cell migration	IMP	10022831
GO:0010745	Process	Negative regulation of macrophage derived foam cell differentiation	IMP	15215180
GO:0010888	Process	Negative regulation of lipid storage	IMP	15215180
GO:0014909	Process	Smooth muscle cell migration	IMP	8837777
GO:0015026	Function	Coreceptor activity	TAS	23125415
GO:0016477	Process	Cell migration	IBA	21873635
GO:0017134	Function	Fibroblast growth factor binding	IDA	18441324
GO:0018215	Process	Protein phosphopantetheinylation	IEA
GO:0019899	Function	Enzyme binding	IPI	21670307
GO:0019960	Function	C-X3-C chemokine binding	IDA	23125415
GO:0030168	Process	Platelet activation	IMP	15466936
GO:0030198	Process	Extracellular matrix organization	TAS
GO:0030949	Process	Positive regulation of vascular endothelial growth factor receptor signaling pathway	TAS	19267251
GO:0031092	Component	Platelet alpha granule membrane	TAS
GO:0031258	Component	Lamellipodium membrane	IDA	25063885
GO:0031527	Component	Filopodium membrane	IDA	25063885
GO:0031528	Component	Microvillus membrane	IDA	25063885
GO:0031589	Process	Cell-substrate adhesion	IMP	19933311
GO:0031994	Function	Insulin-like growth factor I binding	IDA	19578119
GO:0032147	Process	Activation of protein kinase activity	IMP	10022831
GO:0032369	Process	Negative regulation of lipid transport	IMP	15215180
GO:0032587	Component	Ruffle membrane	IDA	25063885
GO:0032880	Process	Regulation of protein localization	ISS
GO:0032991	Component	Protein-containing complex	IDA	15344881
GO:0033627	Process	Cell adhesion mediated by integrin	IBA	21873635
GO:0033627	Process	Cell adhesion mediated by integrin	IDA	12807887
GO:0034113	Process	Heterotypic cell-cell adhesion	IMP	20563599
GO:0034446	Process	Substrate adhesion-dependent cell spreading	IDA	24658351
GO:0034683	Component	Integrin alphav-beta3 complex	IDA	20826760, 22505472, 23726972, 24658351, 25063885, 31331973
GO:0035295	Process	Tube development	TAS	19267251
GO:0035866	Component	Alphav-beta3 integrin-PKCalpha complex	IDA	16014375
GO:0035867	Component	Alphav-beta3 integrin-IGF-1-IGF1R complex	IDA	19578119
GO:0035868	Component	Alphav-beta3 integrin-HMGB1 complex	IDA	20826760
GO:0038027	Process	Apolipoprotein A-I-mediated signaling pathway	IMP	23726972
GO:0038132	Function	Neuregulin binding	IDA	20682778
GO:0042060	Process	Wound healing	IC	8837777
GO:0042470	Component	Melanosome	IDA	15466936
GO:0042802	Function	Identical protein binding	IPI	11606749, 14681217, 22178926
GO:0043184	Function	Vascular endothelial growth factor receptor 2 binding	IPI	10022831
GO:0043184	Function	Vascular endothelial growth factor receptor 2 binding	TAS	19267251
GO:0043235	Component	Receptor complex	IDA	23382219
GO:0043277	Process	Apoptotic cell clearance	IGI	20826760
GO:0045124	Process	Regulation of bone resorption	TAS	19267251
GO:0045202	Component	Synapse	ISS
GO:0045211	Component	Postsynaptic membrane	IEA
GO:0046718	Process	Viral entry into host cell	IMP	25063885
GO:0048010	Process	Vascular endothelial growth factor receptor signaling pathway	TAS
GO:0048333	Process	Mesodermal cell differentiation	IEP	23154389
GO:0050731	Process	Positive regulation of peptidyl-tyrosine phosphorylation	IMP	10022831
GO:0050748	Process	Negative regulation of lipoprotein metabolic process	IMP	15215180
GO:0050839	Function	Cell adhesion molecule binding	IPI	8837777
GO:0050840	Function	Extracellular matrix binding	IDA	22505472
GO:0050900	Process	Leukocyte migration	TAS
GO:0050919	Process	Negative chemotaxis	IMP	23726972
GO:0051611	Process	Regulation of serotonin uptake	ISS
GO:0060055	Process	Angiogenesis involved in wound healing	TAS	19267251
GO:0070051	Function	Fibrinogen binding	IBA	21873635
GO:0070062	Component	Extracellular exosome	HDA	20458337
GO:0070527	Process	Platelet aggregation	IMP	15466936
GO:0071062	Component	Alphav-beta3 integrin-vitronectin complex	TAS	19267251
GO:0098978	Component	Glutamatergic synapse	EXP	18549786
GO:0098978	Component	Glutamatergic synapse	IDA	18549786
GO:0098978	Component	Glutamatergic synapse	IMP	18549786
GO:0099149	Process	Regulation of postsynaptic neurotransmitter receptor internalization	EXP	18549786
GO:0099149	Process	Regulation of postsynaptic neurotransmitter receptor internalization	IDA	18549786
GO:0099149	Process	Regulation of postsynaptic neurotransmitter receptor internalization	IMP	18549786
GO:1905598	Process	Negative regulation of low-density lipoprotein receptor activity	IMP	15215180

MIM	HGNC	e!Ensembl
173470	6156	ENSG00000259207

Protein

UniProt ID

P05106

Protein name

Integrin beta-3 (Platelet membrane glycoprotein IIIa) (GPIIIa) (CD antigen CD61)

Protein function

Integrin alpha-V/beta-3 (ITGAV:ITGB3) is a receptor for cytotactin, fibronectin, laminin, matrix metalloproteinase-2, osteopontin, osteomodulin, prothrombin, thrombospondin, vitronectin and von Willebrand factor. Integrin alpha-IIb/beta-3 (ITGA2

PDB

1JV2 , 1KUP , 1KUZ , 1L5G , 1M1X , 1M8O , 1MIZ , 1MK7 , 1MK9 , 1S4X , 1TYE , 1U8C , 2K9J , 2KNC , 2KV9 , 2L1C , 2L91 , 2LJD , 2LJE , 2LJF , 2MTP , 2N9Y , 2Q6W , 2RMZ , 2RN0 , 2VC2 , 2VDK , 2VDL , 2VDM , 2VDN , 2VDO , 2VDP , 2VDQ , 2VDR , 3FCS , 3FCU , 3IJE , 3NID , 3NIF , 3NIG , 3T3M , 3T3P , 3ZDX , 3ZDY , 3ZDZ , 3ZE0 , 3ZE1 , 3ZE2 , 4CAK , 4G1E , 4G1M

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF17205	PSI_integrin	29 → 76	Integrin plexin domain	Domain
PF00362	Integrin_beta	133 → 381	Integrin beta chain VWA domain	Domain
PF18372	I-EGF_1	463 → 492	Integrin beta epidermal growth factor like domain 1	Domain
PF07974	EGF_2	593 → 624	EGF-like domain	Domain
PF07965	Integrin_B_tail	634 → 718	Integrin beta tail domain	Domain
PF08725	Integrin_b_cyt	742 → 786	Integrin beta cytoplasmic domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Isoform beta-3A and isoform beta-3C are widely expressed. Isoform beta-3A is specifically expressed in osteoblast cells; isoform beta-3C is specifically expressed in prostate and testis.

Sequence

MRARPRPRPLWATVLALGALAGVGVGGPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLG
SPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRP
DDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFG
AFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSR
NRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCH
VGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLS
MDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDT
VSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGT
FECGVCRCGPGWLGSQCECSEEDYRPSQQDECSPREGQPVCSQRGECLCGQCVCHSSDFG
KITGKYCECDDFSCVRYKGEMCSGHGQCSCGDCLCDSDWTGYYCNCTTRTDTCMSSNGLL
CSGRGKCECGSCVCIQPGSYGDTCEKCPTCPDACTFKKECVECKKFDRGALHDENTCNRY
CRDEIESVKELKDTGKDAVNCTYKNEDDCVVRFQYYEDSSGKSILYVVEEPECPKGPDIL
VVLLSVMGAILLIGLAALLIWKLLITIHDRKEFAKFEEERARAKWDTANNPLYKEATSTF
TNITYRGT

Sequence length

788

Interactions

View interactions

	KEGG		Reactome
	Virion - Herpesvirus Rap1 signaling pathway Hormone signaling Phagosome Efferocytosis PI3K-Akt signaling pathway Osteoclast differentiation Focal adhesion ECM-receptor interaction Platelet activation Neutrophil extracellular trap formation Hematopoietic cell lineage Regulation of actin cytoskeleton Cytoskeleton in muscle cells Thyroid hormone signaling pathway Human cytomegalovirus infection Human papillomavirus infection Herpes simplex virus 1 infection Proteoglycans in cancer MicroRNAs in cancer Hypertrophic cardiomyopathy Arrhythmogenic right ventricular cardiomyopathy Dilated cardiomyopathy Fluid shear stress and atherosclerosis		Platelet degranulation Elastic fibre formation PECAM1 interactions Molecules associated with elastic fibres Integrin cell surface interactions Syndecan interactions ECM proteoglycans Integrin signaling GRB2:SOS provides linkage to MAPK signaling for Integrins p130Cas linkage to MAPK signaling for integrins VEGFA-VEGFR2 Pathway Signal transduction by L1 MAP2K and MAPK activation Signaling by moderate kinase activity BRAF mutants Signaling by high-kinase activity BRAF mutants Signaling by BRAF and RAF fusions Paradoxical activation of RAF signaling by kinase inactive BRAF Signaling downstream of RAS mutants

Show/Hide Causal Diseases (9)

Disease term	Disease name	dbSNP ID	References
Causal
Anemia	Anemia	rs118204044, rs118204045, rs118204046, rs121918330, rs869320719, rs869312029, rs121918332, rs869320724, rs767094129, rs786205058, rs786205059, rs137853119, rs137853120, rs137853121, rs1384933966 View all (89 more)
Autism spectrum disorder	Autism Spectrum Disorders	rs724159978, rs75184679, rs119103221, rs9332964, rs121912562, rs1594344233, rs727504317, rs111033204, rs1801086, rs587784464, rs724159948, rs764659822, rs794727977, rs796052733, rs796052728 View all (51 more)	21254450
Autism	Autistic Disorder	rs121964908, rs62643608, rs181327458, rs797046134, rs869312704, rs1555013332, rs876657679, rs1057518999, rs1057518658, rs771827120, rs1555187899, rs773080572, rs753871454, rs1684130791, rs1684180699 View all (8 more)	17203304, 16724005, 16721604
Cerebral palsy	Cerebral Palsy	rs121918149, rs75184679, rs730880264, rs587777428, rs797045067, rs767399782, rs564185858, rs886039513
Developmental delay	Global developmental delay	rs28941770, rs199469464, rs281865469, rs143747297, rs398123009, rs587777428, rs786205133, rs606231459, rs797044854, rs797045027, rs864309504, rs878853160, rs886039902, rs886042046, rs886041291 View all (32 more)
Glanzmann thrombasthenia	Glanzmann Thrombasthenia, Autosomal Dominant, Glanzmann Thrombasthenia, Type A, Glanzmann thrombasthenia	rs879255508, rs137852906, rs763330792, rs137852907, rs879255509, rs137852908, rs780017389, rs137852910, rs76811038, rs137852911, rs80277041, rs121918444, rs121918445, rs121918446, rs2143068731 View all (36 more)	20020534, 18065693, 29380037, 19336737, 1371279, 1602006
Macrothrombocytopenia	Macrothrombocytopenia, Autosomal dominant macrothrombocytopenia	rs121908063, rs5030764, rs121918037, rs80338835, rs80338834, rs80338829, rs121913655, rs80338831, rs121913656, rs80338826, rs80338828, rs587776808, rs80338827, rs121913657, rs876661302 View all (32 more)	19336737, 18065693
Prostate cancer	Malignant neoplasm of prostate	rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582	16158739
Schizophrenia	Schizophrenia	rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346 View all (12 more)	23860687

Show/Hide Unknown Diseases (10)

Disease term	Disease name	References	Source
Unknown
Alloimmune thrombocytopenia	Fetal and neonatal alloimmune thrombocytopenia, Neonatal Alloimmune Thrombocytopenia	19821948, 7694683, 2257303	ClinVar
Coronary syndrome	Acute Coronary Syndrome	15840736	ClinVar
Myocardial infarction	Myocardial Infarction	8598867	ClinVar
Thrombasthenia	Glanzmann's thrombasthenia		GenCC
Glanzmann Thrombasthenia	Glanzmann thrombasthenia 2, Glanzmann thrombasthenia		GenCC
Bleeding Disorder	bleeding disorder, platelet-type, 24		GenCC
Platelet-type bleeding disorder	platelet-type bleeding disorder 16		GenCC
Hypothyroidism	Hypothyroidism		GWAS
Crohn Disease	Crohn Disease		GWAS
Alzheimer disease	Alzheimer disease		GWAS

Show/Hide Text Mining Associations (137)

Disease Name	Relationship Type	References
Associations from Text Mining
Abortion Habitual	Associate	21109038, 22698642
Acute Coronary Syndrome	Associate	16412022
Acute Phase Reaction	Inhibit	27960568
Adenocarcinoma	Associate	25066397
Adenocarcinoma of Lung	Associate	25066397, 28860622
Alzheimer Disease	Associate	28318110
Anemia Sickle Cell	Associate	9840906
Angina Stable	Associate	18035074
Angina Unstable	Associate	10583927, 15346842
Arthritis Rheumatoid	Associate	10792278
Asthma	Associate	15817799, 19264973, 21570717, 23451109
Atherosclerosis	Associate	21322770, 8876221
Autism Spectrum Disorder	Associate	21102624
Autistic Disorder	Associate	17203304, 17999363, 19588468, 21102624
Autoimmune Diseases	Associate	34462261
Bernard Soulier Syndrome	Associate	25370924, 40565512, 8916947
Blood Platelet Disorders	Associate	19336737, 20563533, 22271903, 25728920, 26096001, 26440977, 3006053, 31088191, 31356179, 3165296, 32723322, 33600779, 34066320, 35260724, 37604334, 38007062, 40251671 View all (2 more)
Bone Diseases Metabolic	Associate	40251671
Brain Ischemia	Associate	11514957
Brain Neoplasms	Associate	24289603, 26689941
Breast Neoplasms	Associate	15970922, 21935711, 22791584, 23981902, 25106495, 26167915, 29498809, 29698974, 30336071, 32894234, 39201327, 9695977
Camurati Engelmann Syndrome	Associate	36325441
Cap Myopathy	Associate	19470770
Carcinoma Hepatocellular	Associate	19118033, 31684995, 37603520, 38235317
Carcinoma Non Small Cell Lung	Associate	27901069, 28860622, 29284478, 35805163
Carcinoma Pancreatic Ductal	Associate	33550277, 36905103
Carcinoma Renal Cell	Associate	24862756
Cardiac Output Low	Associate	38007062
Cardiovascular Diseases	Associate	11514957, 20846430, 32723322
Carotid Artery Thrombosis	Associate	10354127
Carotid Stenosis	Associate	30914039
Celiac Disease	Inhibit	24971453
Central Nervous System Diseases	Stimulate	36944577
Cerebral Infarction	Associate	27233747, 30914039
Cholangiocarcinoma	Associate	26517522
Colitis Ulcerative	Associate	16099792
Colorectal Neoplasms	Associate	21622897, 26440977, 36510452, 37241967
Colorectal Neoplasms	Inhibit	39940785
Congenital Abnormalities	Associate	40251671
Conversion Disorder	Associate	19336737
Coronary Artery Disease	Associate	22738689, 27805237, 28086795, 30261890
Coronary Disease	Associate	10583927, 27488401
Coronary Stenosis	Associate	11514957
COVID 19	Associate	33413422, 35415903, 35557984, 37329825
Craniopharyngioma	Associate	24934367
Crohn Disease	Associate	16099792
Dentin Sensitivity	Associate	21570717
Depressive Disorder Major	Associate	27244236
Diabetes Mellitus	Inhibit	32370146
Diabetic Nephropathies	Associate	34104098
Endometrial Neoplasms	Associate	19656390, 26384307
Endometriosis	Associate	26056923
Epileptic Syndromes	Associate	33276370
Fibroadenoma	Associate	37240386
Fibrosis	Associate	32317146
Finger Injuries	Associate	40251671
Fractures Bone	Associate	40251671
Genetic Diseases Inborn	Associate	8876221
Glioma	Associate	24289603, 33036421
Hematologic Neoplasms	Associate	34011073
Hemorrhage	Associate	19172520, 19336737, 1967954, 25734216, 29675921, 3006053, 33600779
Hermanski Pudlak Syndrome	Associate	38007062
Hyper IgM Immunodeficiency Syndrome Type 1	Stimulate	33957723
Hypercholesterolemia	Associate	12189024
Hyperglycemia	Associate	25401697, 32370146
Hypersensitivity Immediate	Associate	1602006
Hypertension	Stimulate	11304415
Hypertension	Associate	19368146
Hypomagnesemia primary	Associate	36199105
Ige Responsiveness Atopic	Associate	15817799
Intracranial Thrombosis	Associate	37175682
Leukemia	Associate	3006053
Leukemia Erythroblastic Acute	Associate	9689055
Leukemia Megakaryoblastic Acute	Associate	3165292
Leukemia Myeloid Acute	Associate	27248172
Leukemia Myeloid Acute	Inhibit	34011073
Lung Neoplasms	Associate	25066397, 27015122, 27041993, 27487131, 30563517, 36453571
Lymphangioleiomyomatosis	Associate	26167915
Lymphatic Metastasis	Associate	18200665, 25472585, 26150443
Lymphatic Metastasis	Stimulate	18395897
Lymphoma Non Hodgkin	Stimulate	17827388
Lymphoma Non Hodgkin	Associate	17827388
Macrothrombocytopenia Autosomal Dominant Tubb1 Related	Associate	19336737, 33276370
Melanoma	Associate	15509546, 29855470, 36091936
Menorrhagia	Associate	36937472
Multiple Myeloma	Associate	34635968, 9649209
Myelodysplastic Syndromes	Associate	22271903
Myelodysplastic Syndromes	Stimulate	9359514
Myocardial Infarction	Associate	10080474, 11514957, 18035074, 27233747, 27805237, 30143348
Myocardial Ischemia	Associate	37892152
Myopathies Structural Congenital	Associate	29799301
Neoplasm Metastasis	Stimulate	18395897
Neoplasm Metastasis	Associate	24264315, 24289603, 26384307, 32844403, 35534983, 36407358
Neoplasms	Associate	15509546, 19775429, 20563533, 22174684, 24289603, 24500664, 24662823, 26158290, 26440977, 27015122, 28860622, 29284478, 30563517, 31523179, 32514015 View all (6 more)
Neoplasms	Stimulate	18395897
Neoplasms	Inhibit	28446539, 32894234, 37241967, 37375208
Neoplasms Cystic Mucinous and Serous	Associate	19775429
Neoplastic Syndromes Hereditary	Associate	34237177
Nervous System Diseases	Associate	28068952
Neurologic Manifestations	Associate	28068952, 32345264
Obesity	Associate	21322770
Ovarian Neoplasms	Associate	17220212, 19876733, 33723319
Pancreatic Neoplasms	Associate	19604247, 30696421, 32514015, 35534983
Paroxysmal ventricular fibrillation	Associate	27759448
Peritonitis	Stimulate	18200665
Phyllodes Tumor	Associate	37240386
Polycystic Ovary Syndrome	Associate	35551681
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Inhibit	11736936
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	36944577
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Stimulate	9359514
Prostatic Neoplasms	Associate	24175814, 26158290, 35265204, 35682554
Purpura Thrombocytopenic Idiopathic	Associate	39808791
Rupture	Associate	21353223
Sarcoma Kaposi	Associate	22174684
Severe Combined Immunodeficiency	Associate	27281793
Squamous Cell Carcinoma of Head and Neck	Associate	24769516
ST Elevation Myocardial Infarction	Associate	37892152
Stomach Neoplasms	Associate	18200665, 19294533, 25472585, 33299895, 37950040
Stomach Neoplasms	Stimulate	18395897
Stroke	Associate	28068952, 35557984
Takayasu Arteritis	Associate	34523592
Thrombasthenia	Associate	10233432, 11588040, 11798398, 1438206, 15748237, 1602006, 1967954, 19691478, 2014236, 23253071, 25728920, 25734216, 25827233, 26096001, 27235135 View all (27 more)
Thrombocythemia Essential	Associate	19508974, 33599741
Thrombocytopenia	Associate	19197137, 19336737, 23253071, 33276370
Thrombocytopenia chromosome breakage	Associate	23253071
Thrombocytopenia Neonatal Alloimmune	Associate	11830467, 25827233, 32770549, 7519475, 8093349
Thrombophilia	Associate	26739544
Thrombosis	Associate	19197137, 33584662
Thyroid Diseases	Associate	36937472
Triple Negative Breast Neoplasms	Associate	32471192
Urinary Bladder Neoplasms	Associate	38073378
Uterine Hemorrhage	Associate	36937472
Varicose Ulcer	Associate	25329616
Varicose Veins	Associate	25329616
Vascular Diseases	Associate	11514957, 25329616
Venous Thromboembolism	Associate	26440977, 26739544
Venous Thrombosis	Associate	11514957, 26261166, 26739544

ITGB3 (integrin subunit beta 3)