Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	3689
Gene name Gene Name - the full gene name approved by the HGNC.	Integrin subunit beta 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	ITGB2
Synonyms (NCBI Gene) Gene synonyms aliases	CD18, LAD, LCAMB, LFA-1, MAC-1, MF17, MFI7
Chromosome Chromosome number	21
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	21q22.3
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes an integrin beta chain, which combines with multiple different alpha chains to form different integrin heterodimers. Integrins are integral cell-surface proteins that participate in cell adhesion as well as cell-surface mediated signalli

Show/Hide all(30)

SNP ID	Visualize variation	Clinical significance	Consequence
rs137852609	G>A	Pathogenic	Missense variant, coding sequence variant
rs137852610	T>C,G	Pathogenic	Missense variant, coding sequence variant
rs137852611	A>G	Pathogenic	Missense variant, coding sequence variant
rs137852612	C>T	Pathogenic	Missense variant, coding sequence variant
rs137852613	T>C	Pathogenic	Missense variant, coding sequence variant
rs137852614	G>A	Pathogenic	Missense variant, coding sequence variant
rs137852615	C>A,T	Pathogenic, not-provided	Missense variant, coding sequence variant
rs137852616	C>T	Pathogenic	Missense variant, coding sequence variant
rs137852617	A>G	Pathogenic	Missense variant, coding sequence variant
rs137852618	C>T	Pathogenic, likely-pathogenic	Missense variant, coding sequence variant
rs148877937	G>A	Pathogenic	Coding sequence variant, stop gained
rs179363873	C>T	Pathogenic, not-provided	Missense variant, coding sequence variant
rs201752283	C>A,T	Pathogenic	Splice donor variant
rs483352813	->G	Pathogenic	Frameshift variant, coding sequence variant
rs483352814	C>T	Likely-pathogenic, pathogenic	Missense variant, coding sequence variant
rs483352815	G>-	Pathogenic	Frameshift variant, coding sequence variant
rs483352816	C>A,T	Pathogenic	Stop gained, missense variant, coding sequence variant
rs483352817	G>-	Pathogenic	Frameshift variant, coding sequence variant
rs483352818	A>G	Pathogenic	Splice donor variant
rs483352819	T>-	Pathogenic	Frameshift variant, coding sequence variant
rs748574145	G>A,T	Pathogenic	Synonymous variant, stop gained, coding sequence variant
rs755600323	C>A,T	Pathogenic	Stop gained, missense variant, coding sequence variant
rs772471533	G>A,T	Likely-pathogenic	Synonymous variant, stop gained, coding sequence variant
rs942375725	C>T	Pathogenic	Stop gained, coding sequence variant
rs1064794297	C>G,T	Likely-pathogenic	Coding sequence variant, missense variant
rs1064794298	A>G	Likely-pathogenic	Coding sequence variant, missense variant
rs1131691763	C>T	Pathogenic	Splice donor variant
rs1568879914	->GA	Likely-pathogenic	Frameshift variant, coding sequence variant
rs1601284455	C>-	Likely-pathogenic	Frameshift variant, coding sequence variant
rs1601302490	G>-	Pathogenic	Frameshift variant, coding sequence variant

Show/Hide all(6)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016972	hsa-miR-335-5p	Microarray	18185580
MIRT021220	hsa-miR-146a-5p	Microarray	18057241
MIRT028899	hsa-miR-26b-5p	Microarray	19088304
MIRT2018311	hsa-miR-136	CLIP-seq
MIRT2018312	hsa-miR-518a-5p	CLIP-seq
MIRT2018313	hsa-miR-527	CLIP-seq

Transcription factors

Show/Hide all(6)

Transcription factor	Regulation	Reference
HIF1A	Activation	15235127
KLF5	Activation	22632819
RUNX1	Unknown	12855590
SP1	Unknown	8670251
SPI1	Activation	9295016
SPI1	Unknown	8670251

Show/Hide all(83)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001540	Function	Amyloid-beta binding	IBA	21873635
GO:0001540	Function	Amyloid-beta binding	ISS
GO:0001774	Process	Microglial cell activation	NAS	18981141
GO:0001851	Function	Complement component C3b binding	ISS
GO:0002523	Process	Leukocyte migration involved in inflammatory response	IEA
GO:0005178	Function	Integrin binding	IBA	21873635
GO:0005178	Function	Integrin binding	NAS	20199584
GO:0005178	Function	Integrin binding	TAS	8020569
GO:0005515	Function	Protein binding	IPI	12208882, 12796480, 16831868, 17321526, 18083624, 19234221, 19828450, 20033057, 20183869, 20679211, 21193407, 25416956, 25910212, 28807980, 31515488, 32296183, 32814053
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	TAS
GO:0005925	Component	Focal adhesion	IBA	21873635
GO:0006898	Process	Receptor-mediated endocytosis	ISS
GO:0006911	Process	Phagocytosis, engulfment	ISS
GO:0006915	Process	Apoptotic process	NAS	12885943
GO:0006954	Process	Inflammatory response	NAS	12885943
GO:0007155	Process	Cell adhesion	IDA	19703720
GO:0007159	Process	Leukocyte cell-cell adhesion	IDA	12885943
GO:0007160	Process	Cell-matrix adhesion	IBA	21873635
GO:0007160	Process	Cell-matrix adhesion	IMP	19029120
GO:0007229	Process	Integrin-mediated signaling pathway	IBA	21873635
GO:0007229	Process	Integrin-mediated signaling pathway	IMP	28807980
GO:0007229	Process	Integrin-mediated signaling pathway	NAS	12885943
GO:0007267	Process	Cell-cell signaling	NAS	12885943
GO:0007568	Process	Aging	IEA
GO:0008305	Component	Integrin complex	IBA	21873635
GO:0008305	Component	Integrin complex	NAS	12885943
GO:0008360	Process	Regulation of cell shape	NAS	12885943
GO:0009897	Component	External side of plasma membrane	NAS	20199584
GO:0009986	Component	Cell surface	HDA	23981064
GO:0009986	Component	Cell surface	IBA	21873635
GO:0009986	Component	Cell surface	IDA	19029120, 19234460, 20563599, 23620790
GO:0016020	Component	Membrane	HDA	19946888
GO:0016477	Process	Cell migration	IBA	21873635
GO:0019221	Process	Cytokine-mediated signaling pathway	TAS
GO:0019901	Function	Protein kinase binding	IPI	12885943
GO:0030101	Process	Natural killer cell activation	IEA
GO:0030198	Process	Extracellular matrix organization	TAS
GO:0030369	Function	ICAM-3 receptor activity	IMP	19029120
GO:0030593	Process	Neutrophil chemotaxis	IDA	12885943
GO:0031072	Function	Heat shock protein binding	IPI	12496435
GO:0031623	Process	Receptor internalization	ISS
GO:0032930	Process	Positive regulation of superoxide anion generation	IGI	21193407
GO:0032930	Process	Positive regulation of superoxide anion generation	NAS	18981141
GO:0033627	Process	Cell adhesion mediated by integrin	IBA	21873635
GO:0034113	Process	Heterotypic cell-cell adhesion	IMP	20563599
GO:0034142	Process	Toll-like receptor 4 signaling pathway	TAS
GO:0034687	Component	Integrin alphaL-beta2 complex	IDA	19029120
GO:0034688	Component	Integrin alphaM-beta2 complex	ISS
GO:0034689	Component	Integrin alphaX-beta2 complex	TAS	8020569
GO:0035579	Component	Specific granule membrane	TAS
GO:0035987	Process	Endodermal cell differentiation	IEP	23154389
GO:0038024	Function	Cargo receptor activity	ISS
GO:0043113	Process	Receptor clustering	IMP	19029120
GO:0043235	Component	Receptor complex	IDA	23382219
GO:0043312	Process	Neutrophil degranulation	TAS
GO:0043315	Process	Positive regulation of neutrophil degranulation	IGI	21193407
GO:0043542	Process	Endothelial cell migration	IEA
GO:0044853	Component	Plasma membrane raft	IDA	21193407
GO:0045123	Process	Cellular extravasation	IEA
GO:0045429	Process	Positive regulation of nitric oxide biosynthetic process	IEA
GO:0045766	Process	Positive regulation of angiogenesis	IEA
GO:0045963	Process	Negative regulation of dopamine metabolic process	NAS	18981141
GO:0046872	Function	Metal ion binding	IEA
GO:0050730	Process	Regulation of peptidyl-tyrosine phosphorylation	IDA	12885943
GO:0050776	Process	Regulation of immune response	TAS
GO:0050839	Function	Cell adhesion molecule binding	IMP	19029120
GO:0050900	Process	Leukocyte migration	TAS
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	IEA
GO:0070062	Component	Extracellular exosome	HDA	20458337
GO:0070821	Component	Tertiary granule membrane	TAS
GO:0071404	Process	Cellular response to low-density lipoprotein particle stimulus	ISS
GO:0090314	Process	Positive regulation of protein targeting to membrane	NAS	18981141
GO:0097242	Process	Amyloid-beta clearance	ISS
GO:0098609	Process	Cell-cell adhesion	ISS	12652296
GO:0098742	Process	Cell-cell adhesion via plasma-membrane adhesion molecules	NAS	20199584
GO:0099568	Component	Cytoplasmic region	IPI	20183869
GO:0101003	Component	Ficolin-1-rich granule membrane	TAS
GO:1901216	Process	Positive regulation of neuron death	NAS	18981141
GO:1903561	Component	Extracellular vesicle	HDA	24769233
GO:1904996	Process	Positive regulation of leukocyte adhesion to vascular endothelial cell	ISS
GO:1990266	Process	Neutrophil migration	IMP	28807980
GO:2000363	Process	Positive regulation of prostaglandin-E synthase activity	NAS	18981141

MIM	HGNC	e!Ensembl
600065	6155	ENSG00000160255

Protein

UniProt ID

P05107

Protein name

Integrin beta-2 (Cell surface adhesion glycoproteins LFA-1/CR3/p150,95 subunit beta) (Complement receptor C3 subunit beta) (CD antigen CD18)

Protein function

Integrin ITGAL/ITGB2 is a receptor for ICAM1, ICAM2, ICAM3 and ICAM4. Integrin ITGAL/ITGB2 is also a receptor for the secreted form of ubiquitin-like protein ISG15; the interaction is mediated by ITGAL (PubMed:29100055). Integrins ITGAM/ITGB2 an

PDB

1L3Y , 1YUK , 2JF1 , 2P26 , 2P28 , 2V7D , 3K6S , 3K71 , 3K72 , 4NEH , 4NEN , 5E6R , 5E6S , 5E6U , 5E6V , 5E6W , 5E6X , 5ES4 , 5XR1 , 5ZAZ , 7P2D , 7USL , 7USM

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF17205	PSI_integrin	23 → 74	Integrin plexin domain	Domain
PF00362	Integrin_beta	122 → 367	Integrin beta chain VWA domain	Domain
PF07965	Integrin_B_tail	622 → 700	Integrin beta tail domain	Domain
PF08725	Integrin_b_cyt	724 → 767	Integrin beta cytoplasmic domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Leukocytes (PubMed:23775590). Expressed in neutrophils (at protein level) (PubMed:21193407, PubMed:28807980). {ECO:0000269|PubMed:21193407, ECO:0000269|PubMed:23775590, ECO:0000269|PubMed:28807980}.

Sequence

MLGLRPPLLALVGLLSLGCVLSQECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPDSI
RCDTRPQLLMRGCAADDIMDPTSLAETQEDHNGGQKQLSPQKVTLYLRPGQAAAFNVTFR
RAKGYPIDLYYLMDLSYSMLDDLRNVKKLGGDLLRALNEITESGRIGFGSFVDKTVLPFV
NTHPDKLRNPCPNKEKECQPPFAFRHVLKLTNNSNQFQTEVGKQLISGNLDAPEGGLDAM
MQVAACPEEIGWRNVTRLLVFATDDGFHFAGDGKLGAILTPNDGRCHLEDNLYKRSNEFD
YPSVGQLAHKLAENNIQPIFAVTSRMVKTYEKLTEIIPKSAVGELSEDSSNVVQLIKNAY
NKLSSRVFLDHNALPDTLKVTYDSFCSNGVTHRNQPRGDCDGVQINVPITFQVKVTATEC
IQEQSFVIRALGFTDIVTVQVLPQCECRCRDQSRDRSLCHGKGFLECGICRCDTGYIGKN
CECQTQGRSSQELEGSCRKDNNSIICSGLGDCVCGQCLCHTSDVPGKLIYGQYCECDTIN
CERYNGQVCGGPGRGLCFCGKCRCHPGFEGSACQCERTTEGCLNPRRVECSGRGRCRCNV
CECHSGYQLPLCQECPGCPSPCGKYISCAECLKFEKGPFGKNCSAACPGLQLSNNPVKGR
TCKERDSEGCWVAYTLEQQDGMDRYLIYVDESRECVAGPNIAAIVGGTVAGIVLIGILLL
VIWKALIHLSDLREYRRFEKEKLKSQWNNDNPLFKSATTTVMNPKFAES

Sequence length

769

Interactions

View interactions

	KEGG		Reactome
	Rap1 signaling pathway Phagosome Hippo signaling pathway Cell adhesion molecules Complement and coagulation cascades Neutrophil extracellular trap formation Natural killer cell mediated cytotoxicity Leukocyte transendothelial migration Regulation of actin cytoskeleton Pertussis Legionellosis Leishmaniasis Malaria Amoebiasis Staphylococcus aureus infection Tuberculosis Human T-cell leukemia virus 1 infection Rheumatoid arthritis Viral myocarditis		Toll Like Receptor 4 (TLR4) Cascade Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell Cell surface interactions at the vascular wall Integrin cell surface interactions Interleukin-4 and Interleukin-13 signaling Neutrophil degranulation

Show/Hide Causal Diseases (5)

Disease term	Disease name	dbSNP ID	References
Causal
Behcet syndrome	Behcet Syndrome	rs886040969, rs886039866, rs746055479, rs752615209, rs774164456, rs751454741	8712863
Dermatitis	Dermatitis	rs61816761, rs150597413, rs138726443, rs201356558, rs149484917, rs372754256, rs747301529, rs567795279, rs745915174	9653089
Leukocyte adhesion deficiency	Leukocyte-Adhesion Deficiency Syndrome, Leukocyte adhesion deficiency type 1, Leukocyte adhesion deficiency type I	rs2134903776, rs121918296, rs121918297, rs121918298, rs121918295, rs28939087, rs28937886, rs137852609, rs137852610, rs137852611, rs137852612, rs387906411, rs137852613, rs137852614, rs137852615 View all (28 more)	9653089, 7686755, 7705401, 25703682, 1590804, 17875809, 1347532, 7472832, 7509236, 1352501, 20529581, 1346613, 1968911, 22134107, 9884339, 20549317, 12488604, 1694220, 26639818 View all (4 more)
Periodontitis	Periodontitis	rs28937571, rs104894211, rs587777534
Tumoral calcinosis	Tumoral calcinosis	rs104894343, rs104894344, rs745655924, rs137853086, rs375879489, rs761396172, rs137853087, rs137853091, rs137853088, rs137853089, rs137853090, rs766750282, rs760830864, rs786205250, rs267606841 View all (4 more)	21335463

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Brain neoplasms	Brain Neoplasms, Malignant neoplasm of brain, Benign neoplasm of brain, unspecified, Brain Tumor, Primary, Recurrent Brain Neoplasm, Primary malignant neoplasm of brain		27935819	ClinVar

Show/Hide Text Mining Associations (163)

Disease Name	Relationship Type	References
Associations from Text Mining
Acne Vulgaris	Associate	31281837
Acquired Immunodeficiency Syndrome	Associate	22664113
Acute Coronary Syndrome	Stimulate	15171817
Acute Coronary Syndrome	Associate	29962384
Adenocarcinoma	Associate	32509861
Adenoma	Associate	26749005
Allergic Fungal Sinusitis	Stimulate	33251550
Alzheimer Disease	Stimulate	23186989
Alzheimer Disease	Associate	25197660, 33773368, 35954209, 37348871, 38554950
Anemia Sickle Cell	Associate	15164377, 15308324, 30630982
Angina Unstable	Associate	12025897, 7594025
Aortic Aneurysm Thoracic	Associate	37883426
Arthritis Rheumatoid	Stimulate	10193433, 37644537, 39379962
Arthritis Rheumatoid	Associate	10873967, 1575573, 8536370
Asthma	Associate	7596088
Atherosclerosis	Associate	21030716, 23918401, 32787365, 34925641, 35241081, 37218975
Atrial Fibrillation	Associate	32389013, 36653368
Biliary Atresia	Associate	34646264
Bone Diseases	Associate	17900349
Brain Ischemia	Associate	15067196
Brain Neoplasms	Associate	26849056
Breast Neoplasms	Associate	29941860, 35441740, 36274054, 36531485
Bronchopulmonary Dysplasia	Associate	14711863
Burkitt Lymphoma	Associate	1691936
Carcinoma Hepatocellular	Associate	37603520, 7927492
Carcinoma Non Small Cell Lung	Associate	30259978, 37370246
Carcinoma Pancreatic Ductal	Associate	24807963
Carcinoma Renal Cell	Associate	19568411, 31950034, 36634939, 36793506, 36854280
Carotid Artery Diseases	Associate	29595698, 34140767, 37861500
Chromosome 12 12p trisomy	Stimulate	24829201
Chromosome 21 monosomy	Associate	1463008, 1975779
Classical Lissencephalies and Subcortical Band Heterotopias	Associate	32922405
Colitis Ulcerative	Inhibit	21921589
Colitis Ulcerative	Stimulate	39328405
Colorectal Neoplasms	Associate	23803696
Common Variable Immunodeficiency	Associate	1733636
Communicable Diseases	Associate	9691093
Constriction Pathologic	Associate	32802883
Coronary Artery Disease	Associate	12717693, 14695458, 17458880
Coronary Artery Disease Autosomal Dominant 1	Associate	37923103
Coronary Disease	Associate	37923103
Coronary Restenosis	Associate	12717693, 8890805
Coronary Stenosis	Associate	14695458
COVID 19	Stimulate	32771640
COVID 19	Associate	36966617
Crohn Disease	Associate	37331566
Developmental Disabilities	Associate	25858935
Diabetes Mellitus	Associate	35592524, 36765354
Diabetes Mellitus Type 1	Associate	35626661
Diabetes Mellitus Type 2	Associate	34813915, 35281591
Diabetic Nephropathies	Associate	34124269, 34735495
Diffuse panbronchiolitis	Associate	9030883
DNA Virus Infections	Inhibit	8652825
Down Syndrome	Associate	11678899, 2842253, 31772502
Down Syndrome	Stimulate	2964960
Drug Hypersensitivity	Associate	37861500
Drug Related Side Effects and Adverse Reactions	Associate	8102559, 9933447
Eosinophilia	Inhibit	39682685
Epstein Barr Virus Infections	Associate	1316791
Epstein Barr Virus Infections	Stimulate	25041527
Fahr's disease	Associate	39740729
Fatigue Syndrome Chronic	Associate	26032326
Fever	Inhibit	26475131
Glioblastoma	Associate	34301218
Glioma	Associate	19423540, 33371165, 34313821, 36714574
Glomerulonephritis IGA	Associate	32894197, 34861820, 36978098
Hashimoto Disease	Associate	34522174
Heart Arrest	Stimulate	9211596
Heart Diseases	Associate	37923103
Heart Failure	Associate	37923103
Hematologic Neoplasms	Associate	16252253
Hepatitis B Chronic	Stimulate	7706478
HIV Infections	Associate	22017400, 8103716
Hypereosinophilic Syndrome	Inhibit	1968426
Hyperlipoproteinemia Type II	Associate	25903419
Hyperplasia	Associate	35586138
Hypertension Pregnancy Induced	Stimulate	12648441
Hypertriglyceridemia	Associate	21030716
Idiopathic Pulmonary Fibrosis	Associate	21309737
Immune System Diseases	Associate	36353617
Immunoglobulin Light chain Amyloidosis	Associate	32922167
Infections	Associate	1316791, 17875809
Inflammation	Associate	10453751, 12855590, 15171817, 1673028, 18426996, 21030716, 23918401, 24659162, 24989171, 2521491, 27118513, 31772502, 32787365, 32922405
Inflammatory Bowel Diseases	Associate	17875809, 27886173
Ischemia	Stimulate	15171817
Kaposiform Hemangioendothelioma	Associate	28099595
Kidney Failure Chronic	Associate	17136029
Leukemia	Associate	11937543, 22207686
Leukemia B Cell	Associate	1381563
Leukemia Lymphocytic Chronic B Cell	Stimulate	24829201
Leukemia Lymphocytic Chronic B Cell	Associate	9885225
Leukemia Lymphoma Adult T Cell	Associate	18702873
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	8400300
Leukemia Myeloid	Associate	12855590, 3118989
Leukemia Myeloid Acute	Associate	10882733, 2562920, 29720577, 34148032, 37904046
Leukemia Plasma Cell	Associate	21526505
Leukemia Promyelocytic Acute	Associate	15108165, 37168856, 9326242
Leukocyte adhesion deficiency type 1	Associate	10564719, 10712675, 1346132, 17244687, 1968911, 21103413, 24338230, 2464599, 25858935, 33391282, 34310689, 35281597, 36353617, 39522300, 9473215, 9884339 View all (1 more)
Leukocyte adhesion deficiency type 1	Inhibit	17875809, 20929531, 2665844, 9312170, 9884339
Leukocyte Disorders	Associate	1347532, 7662985
Lichen Planus	Associate	37317627
Lung Neoplasms	Associate	32549766, 8080732
Lupus Erythematosus Systemic	Associate	37143669, 7515335
Lymphoma	Associate	11937543, 40464949
Lymphoma B Cell	Stimulate	17053842
Lymphoma B Cell	Associate	40464949
Lymphoma Non Hodgkin	Associate	36714574, 36945359
Lymphoma T Cell Cutaneous	Associate	2898211
Mast Cell Activation Disorders	Associate	11967116
Maturity Onset Diabetes of the Young Type 8 with Exocrine Dysfunction	Associate	35498402
Melanoma	Associate	23039186
Multiple Sclerosis	Associate	10877455, 9883968
Muscular Dystrophy Duchenne	Associate	25935398
Mycosis Fungoides	Associate	1281618
Myelodysplastic Syndromes	Inhibit	15147372
Myocardial Infarction	Associate	15067196, 17458880, 23918401, 9426029
Myocardial Infarction	Stimulate	32389013
Nasal Polyps	Associate	36466903
Nasopharyngeal Carcinoma	Associate	33797657
Neoplasm Metastasis	Inhibit	30260245
Neoplasms	Associate	1347707, 1370201, 23803696, 28099595, 33204328, 9933447
Neoplasms	Inhibit	18959781
Neoplasms	Stimulate	34313821
Nephrotic Syndrome	Associate	35173708
Neurodegenerative Diseases	Associate	25197660
Obesity	Stimulate	16034612
Obesity	Associate	18369341, 34555498
Osteoarthritis	Associate	20109188, 29658578, 37379363, 37644537, 39379962
Osteosarcoma	Associate	30260245
Otitis Media	Associate	33391282
Pancreatic Neoplasms	Associate	9566785
Paraparesis Tropical Spastic	Stimulate	12028566
Periodic fever familial autosomal dominant	Associate	37143669
Plaque Amyloid	Associate	38554950
Plaque Atherosclerotic	Associate	34140767
Pneumonia	Associate	37861500
Pre Eclampsia	Associate	33539617
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	10882733
Pulmonary Disease Chronic Obstructive	Stimulate	9577287
Renal Insufficiency Chronic	Associate	39253088
Respiratory Distress Syndrome	Associate	37936685
Retinal Detachment	Associate	17284607, 33391282
Sarcoidosis	Stimulate	1356670
Sarcoidosis	Associate	7518366
Sepsis	Associate	17458880, 33391282
Severe Acute Respiratory Syndrome	Associate	36182530
Severe Combined Immunodeficiency	Associate	9312170
Sjogren's Syndrome	Associate	36171070
Skin Ulcer	Associate	33391282
Sleep Deprivation	Stimulate	8652825
Small Cell Lung Carcinoma	Associate	37215577
Soft Tissue Infections	Associate	33391282
Squamous Cell Carcinoma of Head and Neck	Stimulate	33204328
Stomach Neoplasms	Associate	38425243
Systemic Inflammatory Response Syndrome	Associate	17458880
Thrombocytopenia 1	Associate	20130240
Thrombosis	Associate	14530377, 9426029
Thyroid Cancer Papillary	Associate	35185791
Tremor	Associate	14695458
Tuberculosis	Stimulate	7518366
Uveomeningoencephalitic Syndrome	Inhibit	21297967
Vascular Diseases	Associate	15171817
Vascular System Injuries	Associate	15171817

ITGB2 (integrin subunit beta 2)